KEGG   Thalassolituus oleivorans: TOL_2111Help
Entry
TOL_2111          CDS       T02529                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
tol  Thalassolituus oleivorans
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tol00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2234339..2236084)
Genome map
AA seq 581 aa AA seqDB search
MSDAALGQFAYRLKRIYGNSTDVDALANDLLRVCQNYVEANQRTLLQVPTSADSPRWSEQ
DVILITYGNSIQAPGEVPMQTLAKFLSERLSGTVNAVHILPFFPYSSDDGFSVIDYRQVN
PEWGTWDDVASIAASFDLMADLVINHCSRENLWFVDYIGNHEPYSEYFIEVDPSTDVSLV
TRPRNTPLLTPVHTHRGVRHVWATFSEDQIDLNFANPKVLLEFIQIYLFYIERGARFIRL
DAVAFLWKQIGTRCLHLPQTHEVVKLLRDVVNFVAPEVVVITETNVPVVENLSYFGESDE
AHMVYQFGLPPLVLHALNRGNSSFISDWADSIPVLPKGCTYLNFTASHDGIGVRPVEGIL
PEREVQDLIDCMHRFGGFVSMKANSDGSESPYEINITLFDACMGTRRGVDHFQVQRFLCS
QAIMLAMQGIPALYIHSFTASANDLAHVEQTGRTRSINRKVWDKDELEYLLSNSVTAQAE
VFHELSRMIRIRRKQPAFSPDARQDVVKINSDVFILKRTSVDASQRIYAISNVTERILKL
PLAALGFLENGLMDILALEPTTLIDELVLYPYQTVWLTQSV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgctgcgctcggacagttcgcttaccgtttaaaacggatttatggaaactca
acagacgtcgatgcactcgctaacgaccttctgcgtgtctgccaaaactatgttgaagca
aatcagcgcacgttactccaagtgccgaccagtgcagattctccgcgctggtctgaacaa
gacgttattttaattacttacggcaatagtattcaggcgcccggagaggtgcctatgcaa
acactcgccaaatttttgtctgagcgcttgtccggaacggtcaacgctgtgcatatttta
ccgttttttccctacagttcggatgatggtttttcggtaattgattatcgccaagtcaat
ccggagtggggtacttgggatgatgttgcgagtattgctgcgtcgtttgatttaatggcc
gacctagtcatcaatcattgttcacgtgaaaatttgtggtttgttgattacatcggtaat
catgaaccctattcggaatactttatcgaggttgatccaagtacggatgtttctttggtc
acgcgcccacgcaatacgccgttgttgactcctgtgcatacccatcgaggtgttcgccac
gtatgggcgacttttagtgaagaccagatagatttgaactttgccaatcccaaagtattg
ctcgaatttattcagatttatttgttttatattgaacgcggggcacgctttattcgactc
gatgccgtggcctttttgtggaaacaaattggtacgcgttgtttgcatttgccgcagact
cacgaggtggtaaaactgctgcgtgatgtcgtcaattttgtagctcctgaagtcgtcgta
attactgaaaccaatgtgccagttgtcgaaaatctaagctattttggtgaatctgacgaa
gcgcatatggtatatcaatttggcttacctcctttggtattgcacgctttaaatcgaggc
aattcatcctttatatcggattgggctgactctattcctgtattgcctaaaggatgtacg
tatttaaacttcacggcatcgcatgatggcattggggttcgtcctgtggaggggattcta
cctgagcgggaggtacaagatttaatcgactgcatgcatcgttttggtggctttgtgagc
atgaaagcgaatagcgatggtagcgaaagcccatatgaaataaacattacgctattcgat
gcgtgtatggggacaaggcgcggggttgatcattttcaagttcagcgcttcttatgttct
caagctattatgttggcgatgcagggcattcctgcactgtatattcatagctttactgca
tcggcgaatgatttagcccatgtggagcaaacaggacgtacgcgatccatcaatcgtaag
gtttgggataaagacgagctagaatatttgttatcgaattcggtaacggcacaagcggaa
gtttttcacgaattgagtcgtatgattcggattcgacgcaaacaaccggcgtttagccct
gatgctcgccaagatgtggtgaaaattaactctgacgtatttattttaaagcgtaccagt
gttgatgcttcgcaacgtatctatgcgatatcgaatgtgacggagcggatacttaaattg
ccgttagcggcattgggatttttagaaaatggcttgatggatattcttgcgttggaacca
acgactttgatcgacgagctagtcttgtacccctatcaaacggtttggcttactcaaagt
gtttag

DBGET integrated database retrieval system