KEGG   Thalassolituus oleivorans: TOL_2424Help
Entry
TOL_2424          CDS       T02529                                 

Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tol  Thalassolituus oleivorans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tol01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tol00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2549461..2551062)
Genome map
AA seq 533 aa AA seqDB search
MSAYQDEIKALSSVIEANGSPWAAISAESAARMRVQNKFKTGLDIAKYTANIMRADMAAF
DADKSKYTQSLGCWHGFVGQQKLISIKKHFGTTERKYLYLSGWMVAALRSEFGPLPDQSM
HEKTAVASLVAELYTFLRQADARELGMLFRELDAAREAGDTAKAAEIQDKVDNYETHIVP
IIADIDAGFGNAEATYLMARQMIEAGACCLQIENQVADEKQCGHQDGKVTVPHADFHNKL
RALRYAFLELGIDNGLIVARTDSEGAGLTKEIAVVKEPGDAGDIYNSFLDVEEIDVADMA
EGDVVFNRGGKLVRPKRLPSGLYQFRQGTGHERCVFDCIGAIDAGADLLWIETAIPTVHE
IAGMMNEVRKVHPDAKLVYNNSPSFNWTLSFRQQAYDAMVAAGEDVSAYDRAKLMSADYD
GTELCDRADAMIQSFQADTSREANVFHHLITLPTYHTTALSVDNLAKEYFGEAGMLGYVA
GVQRKEIRQGIACVKHQNMAGSDMGDDHKEYFAGENALKAGGAKNTSNQFNNI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttatcaagatgaaatcaaagcgttgagcagcgttattgaagcaaacggcagc
ccatgggccgctatcagtgctgaatctgcagctcgtatgcgtgtacagaacaaattcaaa
actggtctagatatcgctaagtacactgcaaacatcatgcgtgcagatatggctgcgttc
gatgccgacaaatctaagtacactcagtctttgggttgctggcatggtttcgtaggtcag
caaaagctgatctctatcaaaaagcatttcggtactactgaacgtaaatacttgtaccta
tctggttggatggttgcagcactacgttctgagttcggtcctcttcctgaccagtcaatg
cacgaaaaaactgcagtagctagcctagttgctgagttatacactttcttgcgtcaagct
gatgcacgtgaactaggtatgttgttccgtgaactagacgcagctcgtgaagctggtgac
actgctaaagcagctgaaatccaagataaagttgataactacgaaactcacatcgtacct
atcattgctgatatcgacgctggtttcggtaacgctgaagcaacttacttgatggctcgt
caaatgatcgaagcaggcgcttgctgcttgcagatcgaaaaccaagttgctgatgaaaag
caatgtggtcaccaagacggcaaagtgactgttccacacgctgacttccacaacaagtta
cgcgcattgcgttacgcgttccttgagttaggtatcgacaacggtcttatcgttgcacgt
actgactctgaaggtgctggcctgactaaagaaatcgctgttgttaaagagccaggcgat
gctggcgatatctacaactctttcctagacgttgaagaaatcgacgtagctgatatggct
gaaggcgatgttgtattcaaccgtggtggcaagctagtacgtcctaagcgtctaccttct
ggtctataccaattccgtcaaggcactggccatgagcgttgtgtatttgactgtatcggt
gctatcgatgcgggcgctgacttgttgtggatcgaaactgcaatcccaacagttcacgaa
attgctggcatgatgaacgaagttcgtaaagttcacccagatgcgaaacttgtttacaac
aacagcccatctttcaactggactttgagcttccgtcaacaagcatacgacgctatggtt
gctgctggtgaagacgtatctgcatacgatcgcgctaagctaatgtctgctgactacgat
ggtactgagctttgtgatcgtgctgacgctatgattcagtctttccaagctgatacttca
cgtgaagcgaacgtgttccaccacttgatcactctgcctacttaccacacgactgcattg
tctgttgataacttggctaaagagtacttcggtgaagcgggcatgttgggttatgttgct
ggcgttcagcgtaaagagatccgtcaaggcatcgcttgcgttaagcaccagaacatggct
ggttcagacatgggcgacgaccacaaagaatactttgctggtgaaaacgctctgaaagct
ggcggcgctaagaacacttctaaccagttcaacaacatctaa

DBGET integrated database retrieval system