KEGG   Thalassolituus oleivorans MIL-1: TOL_2424Help
Entry
TOL_2424          CDS       T02529                                 

Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tol  Thalassolituus oleivorans MIL-1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TOL_2424
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TOL_2424
Enzymes [BR:tol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TOL_2424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2549461..2551062)
Genome map
AA seq 533 aa AA seqDB search
MSAYQDEIKALSSVIEANGSPWAAISAESAARMRVQNKFKTGLDIAKYTANIMRADMAAF
DADKSKYTQSLGCWHGFVGQQKLISIKKHFGTTERKYLYLSGWMVAALRSEFGPLPDQSM
HEKTAVASLVAELYTFLRQADARELGMLFRELDAAREAGDTAKAAEIQDKVDNYETHIVP
IIADIDAGFGNAEATYLMARQMIEAGACCLQIENQVADEKQCGHQDGKVTVPHADFHNKL
RALRYAFLELGIDNGLIVARTDSEGAGLTKEIAVVKEPGDAGDIYNSFLDVEEIDVADMA
EGDVVFNRGGKLVRPKRLPSGLYQFRQGTGHERCVFDCIGAIDAGADLLWIETAIPTVHE
IAGMMNEVRKVHPDAKLVYNNSPSFNWTLSFRQQAYDAMVAAGEDVSAYDRAKLMSADYD
GTELCDRADAMIQSFQADTSREANVFHHLITLPTYHTTALSVDNLAKEYFGEAGMLGYVA
GVQRKEIRQGIACVKHQNMAGSDMGDDHKEYFAGENALKAGGAKNTSNQFNNI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttatcaagatgaaatcaaagcgttgagcagcgttattgaagcaaacggcagc
ccatgggccgctatcagtgctgaatctgcagctcgtatgcgtgtacagaacaaattcaaa
actggtctagatatcgctaagtacactgcaaacatcatgcgtgcagatatggctgcgttc
gatgccgacaaatctaagtacactcagtctttgggttgctggcatggtttcgtaggtcag
caaaagctgatctctatcaaaaagcatttcggtactactgaacgtaaatacttgtaccta
tctggttggatggttgcagcactacgttctgagttcggtcctcttcctgaccagtcaatg
cacgaaaaaactgcagtagctagcctagttgctgagttatacactttcttgcgtcaagct
gatgcacgtgaactaggtatgttgttccgtgaactagacgcagctcgtgaagctggtgac
actgctaaagcagctgaaatccaagataaagttgataactacgaaactcacatcgtacct
atcattgctgatatcgacgctggtttcggtaacgctgaagcaacttacttgatggctcgt
caaatgatcgaagcaggcgcttgctgcttgcagatcgaaaaccaagttgctgatgaaaag
caatgtggtcaccaagacggcaaagtgactgttccacacgctgacttccacaacaagtta
cgcgcattgcgttacgcgttccttgagttaggtatcgacaacggtcttatcgttgcacgt
actgactctgaaggtgctggcctgactaaagaaatcgctgttgttaaagagccaggcgat
gctggcgatatctacaactctttcctagacgttgaagaaatcgacgtagctgatatggct
gaaggcgatgttgtattcaaccgtggtggcaagctagtacgtcctaagcgtctaccttct
ggtctataccaattccgtcaaggcactggccatgagcgttgtgtatttgactgtatcggt
gctatcgatgcgggcgctgacttgttgtggatcgaaactgcaatcccaacagttcacgaa
attgctggcatgatgaacgaagttcgtaaagttcacccagatgcgaaacttgtttacaac
aacagcccatctttcaactggactttgagcttccgtcaacaagcatacgacgctatggtt
gctgctggtgaagacgtatctgcatacgatcgcgctaagctaatgtctgctgactacgat
ggtactgagctttgtgatcgtgctgacgctatgattcagtctttccaagctgatacttca
cgtgaagcgaacgtgttccaccacttgatcactctgcctacttaccacacgactgcattg
tctgttgataacttggctaaagagtacttcggtgaagcgggcatgttgggttatgttgct
ggcgttcagcgtaaagagatccgtcaaggcatcgcttgcgttaagcaccagaacatggct
ggttcagacatgggcgacgaccacaaagaatactttgctggtgaaaacgctctgaaagct
ggcggcgctaagaacacttctaaccagttcaacaacatctaa

DBGET integrated database retrieval system