KEGG   Thalassolituus oleivorans MIL-1: TOL_2704Help
Entry
TOL_2704          CDS       T02529                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tol  Thalassolituus oleivorans MIL-1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tol00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TOL_2704
Enzymes [BR:tol01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     TOL_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2844145..2845626)
Genome map
AA seq 493 aa AA seqDB search
MGIDTHQEPVVYMRRDCHVATSEGFNAMSRIRVNTAQTSIIATLVLVCSDLLSHQQAGLS
EAAWRLLHCPVDGESAWFHHAQPVDSMSQVRGKLYGHRLTAASAKNIITDIRAGRYSDIQ
LAAYVTACAGDRLNLDETIAITQAMVASGEHFDWGIDQVLDKHCVGGLPGNRTTPIVVAI
VAANGLVMPKTSSRAITSPAGTADTMEVLTNVNLSFDLMREVVQKEGACLAWGGSVSLSP
ADDMIIRVERALDLDSEGQLVASVISKKVAAGAKQVLLDIPVGPTAKVRSAEKAQRLRQL
LESTGRALGLDVRTIITDGSQPVGRGIGPALEARDVLQVLQNDGHAPQDLRDKSLLLAAH
LLEMGGKAEVGHGLALAQSTLISGQAWDKFRAICAAQGGLKLIESADFSHCVRATSSGVV
AYINNRFIARLASLAGAPNAPTAGMDLHVRLGDDINQGDPLFTLYAEAPGELAYALDFLD
GHTDVIRIEREMV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggggattgatacgcatcaggagcctgtcgtttacatgcgccgcgactgtcatgtcgca
acctcagaaggctttaatgcgatgagtcgtatccgtgtgaacacggcgcagactagtatt
attgcaacgctggttcttgtttgctcggatttgttatcgcatcagcaagcgggattgtcg
gaggcggcctggcgtttattgcactgcccagtcgacggcgagtcggcatggtttcatcat
gcccagcctgtggattctatgtctcaggtacgcggcaaactttatggtcatcggctaacc
gccgccagtgcgaaaaatattattactgatattcgcgcaggtcgttacagcgatattcag
cttgcagcgtacgtgacggcttgcgctggcgatcgtttaaatttagatgaaaccatcgcg
attacccaagcaatggtggccagtggtgagcatttcgattggggtattgaccaggtgtta
gataaacactgcgttggcggtttacccggtaatcgtaccactccgattgttgtcgctatt
gttgccgccaatggcttagtgatgccaaaaacctcaagtcgcgcgattacgtcgcctgcg
ggaaccgccgatacgatggaggttctgaccaacgtcaatttaagcttcgatctgatgcgc
gaggtcgtgcaaaaagaaggcgcctgtttggcttggggtggttctgtgagtttgagccca
gcggacgacatgattattcgtgttgagcgggctctggatttggatagcgaaggtcagtta
gtcgcctcggttatttcgaaaaaagtcgccgcaggtgctaagcaagtgctgcttgatatt
cctgtcgggcctaccgctaaagtgcgttctgccgaaaaagctcagcgtttacgccaacta
ctggaaagtaccggtcgggcgttaggtttggatgtgcgtactattattacggatgggtcg
cagccagtagggcgaggtataggcccagcactagaggctcgcgatgttctgcaagtattg
caaaatgatggtcatgctccacaagatttacgtgataaatcgctgttattggctgcgcac
ttattagaaatgggtggcaaagcagaggtcggtcatggtttagctttggcacaaagcact
ctgattagtggccaagcatgggataaatttcgcgcgatttgtgcggctcagggtggctta
aaattgatcgagagcgccgattttagtcattgtgtgcgcgccacatcaagtggggtagtg
gcctatattaataatcgttttattgcgcgtttagcgtcgttggcgggagcacccaatgct
ccgacagctggcatggatctgcatgtgaggctcggtgacgatattaatcaaggtgatcca
ttatttaccttatatgccgaagcgccgggtgaacttgcgtatgctttagactttttagac
gggcataccgatgttattcgcattgagcgggagatggtgtaa

DBGET integrated database retrieval system