KEGG   Thalassolituus oleivorans MIL-1: TOL_2810Help
Entry
TOL_2810          CDS       T02529                                 

Definition
Fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tol  Thalassolituus oleivorans MIL-1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tol00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TOL_2810
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TOL_2810
Enzymes [BR:tol01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     TOL_2810
Lipid biosynthesis proteins [BR:tol01004]
 Desaturase
  First
   TOL_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2956802..2957764
Genome map
AA seq 320 aa AA seqDB search
MNEPLQKRSLWKNVQRWIDSSIDNDEPMTSTEFNWVRTMPFIILHLACFGVLVTGVSTTA
VVVCLALFWLRLFAITAFYHRYFSHRSYKTSRPAQFIFALLGNMSAQRGPLWWAAHHRAH
HQHADTDDDLHSPVKRGFWWSHAGWFTCDASFKTQMHRINDFAKYPELRWLDRYDIFAPM
LLLALLFVAGELLAAFAPALETNGLQLIVWGFVISTVILFHSTVTINSLGHIWGKKRFNN
KDESRNNAILALLTLGEGWHNNHHRWAVSARQGFYWYEIDITYGILKVMSWLGIVWDLSP
VPAHVLEEGRRANNNRKDAK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagccattacagaagcgatcactgtggaaaaacgtgcagcgctggatcgactcc
agcatagataacgatgaaccgatgacaagcaccgagtttaactgggtgcggaccatgcca
tttattattttgcatttggcctgcttcggcgtactcgttactggcgttagcaccactgca
gtagtggtatgtctggccctattttggctgcgtttatttgctattacagcattttatcac
cgctacttttctcatcgctcgtacaaaactagccgcccagcccaatttatttttgcctta
ctcggcaatatgtcagcccagcgcgggccactttggtgggcagcacaccatcgcgcacat
catcaacatgccgatactgatgatgaccttcactcaccggtaaagcgtggtttttggtgg
agtcacgcgggttggtttacatgtgatgccagtttcaaaacacaaatgcaccgtattaac
gatttcgctaaatacccagaattacgctggctagaccgctacgatatctttgcccctatg
ttgttattagccttgttattcgtcgccggtgaacttttagcagctttcgctccggctctt
gaaactaatggtctacaactcattgtctggggctttgtgatatccaccgtgatcttattc
cattccacagtgaccattaattcccttggccatatatggggaaaaaagcgcttcaacaac
aaagatgaaagccgtaacaacgcaatactagccttactcacactaggcgaaggctggcac
aacaatcatcaccgctgggcggtgtctgcgcgccaaggcttttactggtacgaaatagat
attacgtacggcattctcaaagtgatgagttggttgggaattgtttgggatttaagccca
gtgcctgctcatgtattagaagaaggtcgtcgcgccaacaataatcgcaaggatgcaaag
taa

DBGET integrated database retrieval system