KEGG   Thalassolituus oleivorans MIL-1: TOL_3041Help
Entry
TOL_3041          CDS       T02529                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
tol  Thalassolituus oleivorans MIL-1
Brite
KEGG Orthology (KO) [BR:tol00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    TOL_3041
Enzymes [BR:tol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     TOL_3041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3198850..3200349
Genome map
AA seq 499 aa AA seqDB search
MKLSYDTIIIGSGFGGSVAASTLSSAGQNVLLIERGPWRDSAAVRAAGIQNASSLPKGYS
SYLDLLHRVGYSKIKGTGKRLNRHGLFDIHFGSEMTVVCSNGVGGGSHVYSAMNTRPANN
QYWNHRSNELSATSMEEHYQWMISTMSAKEPNIDDKIPNFTGERFASSPHFIANDKTGQP
AMSVSMNGDAENYRDNSFFGSENGAKATLDRILLIPAKAQGLEIAALHECLSIWKTHEGY
RLEVMDHNAKRIRQFSAKRVILAAGTLNTLRLLFRSRALGGLTGLKNLGHGFGGNGDVPG
YWAVNEAGADFTQGIPCHGRFALRDSKGDIEILPDLLPVDLTSYGLNGIGNLPMPSFLRR
RLKQDLVVVGMGSDNADGVVEWHNGKLSIHYIRQNNPILKSICRHFDEIARRSQRPIYYT
ERHPLTVHPLGGARLSATPDEGVINGNGEVWDSPGLFIADASALPAAPGTPPSMTISAWS
RHVALKILTQQNNNSGINR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgagctacgacaccataattattggtagtggtttcggcggctctgttgccgcg
agtacactatcgagtgctggacaaaatgttctgttaattgagcgcggtccttggcgcgat
agcgcggctgtccgcgctgctggaatacaaaacgctagctctctacctaaaggatattct
tcttatttagatctattacatcgcgttggctattcaaaaatcaaggggacaggaaaacgg
ttaaaccgccatggtctgtttgatattcatttcggcagcgaaatgaccgtcgtttgctcg
aatggcgttggcggcggcagtcatgtctatagtgcaatgaatactcgcccagctaacaat
caatattggaatcaccgcagtaacgaattgtccgccaccagcatggaagaacattatcaa
tggatgatttcaaccatgagcgcaaaagaacctaacatcgacgataaaatacctaatttt
accggcgagcgttttgcttcgtcaccacacttcatcgctaacgataaaaccggtcagcct
gcgatgtcggtatccatgaatggcgatgccgaaaattatcgtgataatagttttttcggc
agtgagaatggagcgaaagcaacacttgatcgaatcctgttgattcctgcaaaggcacaa
ggattggagatagcggcattacatgaatgtttaagcatttggaaaactcatgaaggctat
cgtttagaggtgatggatcacaatgctaaacgtatccgacaattcagtgctaagcgcgtc
atattagccgcaggaacattgaataccttacgattattatttcgtagtcgcgcactaggc
ggcctaacagggctcaagaaccttggtcatggctttggtggcaatggtgatgtacctggg
tattgggcagtcaatgaagccggagctgatttcacccaaggcatcccctgccatggtcgt
tttgcattacgcgatagcaaaggtgatatagaaatattacccgatttattaccagtcgac
ctgacgagctatggattaaatggtatcggcaatttaccgatgcccagctttttacgtcga
cgtttaaaacaagacttagttgtcgttggcatgggttctgacaatgccgatggcgttgtc
gagtggcataacggcaaactaagcattcattacatacggcaaaataatccaatattaaaa
agtatctgccgccattttgacgaaatagcgcgccgcagtcagcgacccatttattatacc
gaacgccatccactaactgtccatccactcggtggtgcacgtttatcagccacaccagat
gagggcgttattaatggcaatggtgaggtttgggatagccctggtttatttattgccgat
gcgagtgccttgccagcagctcctgggactccaccatcaatgacaatttctgcatggtca
cgtcacgtagcgctaaaaatattaacacagcaaaataacaactcaggaatcaatagatga

DBGET integrated database retrieval system