KEGG   Thalassolituus oleivorans: TOL_3087Help
Entry
TOL_3087          CDS       T02529                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tol  Thalassolituus oleivorans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tol01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tol00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3245065..3246369)
Genome map
AA seq 434 aa AA seqDB search
MTISIRRFRSDQADFAAQMDALLSWESVSDTGVQQIVTDIVNDVRKRGDMALIEYTNRFD
RMNVDSMAQLELSQEQLQTALDGLPDAQRAALTTAAERVRSYHEKQKTDSWQYTEADGTV
LGQKVTPMDRVGIYVPGGKAAYPSSVLMNAIPAHVAGVSEIIMVVPTPDGELNQLVLAAA
AAAGVSRVFTVGGAQAVAALAYGTATVPQVDKIVGPGNIFVATAKRMVFGVVGIDMIAGP
SEILVVCDGDTNPDWIAMDLFSQAEHDEDAQSILVSTDPDFLDAVAASIEKLLPTMERAD
IIRTSLTERGALIHAADKADALNLINRIAPEHLELSVADPEAWLPEIRHAGAIFMGRYTA
EALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIQCSADGASELGKVASILARGEH
LTAHARSAEYRIKD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactatttctattcgtcgttttcgttctgatcaggctgattttgcagcacaaatggat
gccttgctgtcttgggaatctgtgtcagatactggtgtacagcagatcgtcaccgacatc
gttaatgatgttcgtaagcgcggcgatatggcattaattgaatacactaatcgtttcgac
cgcatgaatgttgattcaatggcgcagctagaactgagccaagaacaactgcaaacagca
ctcgacggtttacctgatgcacagcgcgcggcgttaacaactgcggcagagcgcgtgcgt
agttaccacgaaaaacaaaaaactgactcttggcaatacactgaagctgatggcactgtc
ctaggccaaaaagtaacgccgatggatcgcgtgggaatttatgttcccggtggtaaagca
gcgtatccatcatcagtattgatgaatgcgattcctgcgcacgttgccggtgtttctgaa
attattatggtggtgccaaccccggatggtgagttaaatcaattggtgctggctgctgct
gcggctgctggtgtttctcgcgtatttaccgtaggtggtgcgcaggctgttgcggctttg
gcgtatggcaccgcaaccgttcctcaagtcgataaaattgtgggtccaggtaacatcttt
gttgctaccgctaagcgtatggttttcggtgttgttggtattgatatgatcgctggtcca
tccgaaattttggtggtgtgcgatggcgataccaatcctgactggattgcgatggattta
ttctcgcaagctgagcacgatgaagatgcgcagtcgattttagtatcgaccgatcccgac
tttttagatgcggttgccgcaagcattgaaaaattactaccgacaatggaacgtgcggat
attattcgtacctcgcttactgagcgtggtgcattaattcatgcagcggataaagccgat
gcgttgaatttaattaatcgcattgcgcccgagcacttagagttatcggttgcagatcct
gaagcttggttgcccgaaattcgccatgccggtgctatttttatgggccgttatacggca
gaggccttgggcgattattgcgctgggccaaaccacgtattaccaacatcgggcaccgcg
cgtttctcttcgccattaggtgtgtacgatttccagaagcgttcatcgttaattcaatgt
tcggcggatggtgcatcggagctgggtaaggtcgcttcgatcttagcccgtggtgagcat
ttaactgcgcacgcacgttcggcggaataccgtattaaagattaa

DBGET integrated database retrieval system