KEGG   Thalassolituus oleivorans MIL-1: TOL_3265Help
Entry
TOL_3265          CDS       T02529                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
tol  Thalassolituus oleivorans MIL-1
Brite
KEGG Orthology (KO) [BR:tol00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    TOL_3265
Enzymes [BR:tol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     TOL_3265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3439351..3441006)
Genome map
AA seq 551 aa AA seqDB search
MTSNPLSRRKFLGLSALTTASAYGLTTVSLLSAQKAEAGWFSKPELAIPDSPNAIASHYP
AIVIGSGYGSAVSALRLGEAGIETLMIEMGMLWDKPASDDKIFTKTTAPDGRSMWFKDRT
EAPLENFFGLNVINRDIEQYPGVLDRVRYDNMSVYVGRGVGGGSLVNGCMAVTPRRDYFE
TILPNVSADDMYDTYFPLANSMLGVNNVTEELFESKYYQFSRVAQKAAINAGFKTANVPS
SYDFGYMQQEADGDAPKSALDGEVIYGNNGGKQSLDKNYIPAAIGTGHVTLRTLTKVTKI
EQDANGVYSLSLETIDVTGAVVETLQVSCNQLFLGAGCLGTTELLVRARDTGTLPLLNSE
VGKGWGNNGNIMFACSTRFWNGTGVAQSTMPVMGIDNWDDPEHPVFAEIAPFPTGIETWT
SLFLAITKNPERGYFTYNAAADSVDLNWDATQTATSYNDSKWLFDKMNAANRTKYRTGLF
ADNKYYADDFTYHPLGGCLLGKATDDYGRVKGYNNLYVVDGSLIPGSVGVNPYVTITALA
ERNIEHVIAND
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgactagcaatcctctctcgcgtcgtaaatttctcggcttatcagcgcttacaacggcg
tcagcttatgggctaacaaccgttagtctcctttccgcgcaaaaagcagaggcgggatgg
ttttccaaacctgaattggctatccctgacagccctaatgctattgcatcccactatccg
gctattgtcatcggtagcggatacggcagtgcggtctcggcattgcggttgggtgaggcc
gggattgagacgctgatgattgagatggggatgttgtgggataagccggcatctgatgac
aaaatattcactaaaacgacagcccctgacgggcgttcgatgtggtttaaagatcgtact
gaagcgccgctcgaaaatttctttggtttgaatgttattaatcgcgatattgaacagtat
cccggagtgcttgatcgtgttcgttacgacaatatgtcggtttatgtgggtcgcggtgtc
ggcggtggttctctagttaacggctgtatggcggttactccgcgtcgtgattacttcgag
actattttgccgaatgtctcagctgatgatatgtacgatacctacttcccgcttgcgaat
agcatgctaggtgtgaataacgtgacggaagagttattcgaatctaagtactatcagttc
tcgcgggttgctcaaaaggcggctatcaatgccgggttcaaaactgcaaatgttccgagt
agctatgactttggatatatgcagcaagaggccgatggtgatgcgcctaagtcggcgctt
gatggtgaggttatctacggtaataacggtggcaagcagagcctcgataaaaactatatt
cctgcagctattggtactggtcacgtgactctgcgcacgctgactaaggtgactaagatc
gagcaagatgccaatggagtgtattccttatcgctcgaaacgattgatgttacaggtgcc
gtggtcgaaacattacaggttagctgtaaccaactgtttttaggcgcgggctgtctcggt
acgactgagcttttggtgcgcgcgcgtgatactggcacattaccgctgctgaattctgag
gtaggaaaggggtggggcaataacggtaatattatgtttgcgtgttcaacgcgcttttgg
aatggcactggcgtcgcgcaatcgacaatgccggtcatggggattgataactgggatgat
cctgagcatccggtgtttgccgaaatcgctcctttcccaactggtattgaaacctggacc
agcttgtttttagcgattactaaaaacccagaacgtggatattttacctacaatgcggct
gcggatagtgttgatttaaattgggatgcgacgcaaacagcaacttcttataacgatagt
aaatggttgttcgataagatgaacgcggccaatcgaacgaaataccgtacgggattgttt
gcggataataaatattacgcggatgacttcacctatcatccgttaggtggttgtttgctg
ggtaaggcaaccgacgattatggccgtgtgaagggctacaacaacttgtatgttgttgat
ggttctctaatcccaggcagtgttggtgtaaatccttatgtcaccatcactgcccttgct
gaaagaaatattgagcacgtcattgctaacgactag

DBGET integrated database retrieval system