KEGG   Thermococcus onnurineus: TON_0147Help
Entry
TON_0147          CDS       T00789                                 

Definition
(GenBank) tryptophan synthase beta subunit-related protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ton  Thermococcus onnurineus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TON_0147
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TON_0147
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TON_0147
Enzymes [BR:ton01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TON_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(121958..123289)
Genome map
AA seq 443 aa AA seqDB search
MKAVLPDSKMPKRWYNILPDLPEPLAPPLDPETDEPMESEKLLRIFASELVKQEMSMERY
IDIPKKVRELYAKIGRPTPLFRATNLEKALETPARIYFKYEGATVTGSHKINTALAQAYY
AKKQGIERLVTETGAGQWGTALSLAGALMGINVRVYMARASFYQKPYRKTIMRLYGAEIY
PSPSDRTEIGRKFLSEDPNHPGGLGIAISEAIEDVLRDEKARYALGSVLNHVLMHQTVIG
LEAKEQMKEFEDPDVIIGCVGGGSNFAGLAYPFVKDRLDGKADYEFIAVEPRAAPSMTRG
VYTYDYGDSGGLTPKMKMHTLGHTYYVPPIHAGGLRYHGLAPTLSILINHGIVRPVAYHQ
TEVFEAARLFAKTEGIVPAPESAHAVKAAIDRALKAKEEGKEEVILFNLSGHGLLDLKGY
EDFLDGKLEDYEPEELPALRGEV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttctgccagattccaaaatgccaaagaggtggtacaacatcctgccagac
ctaccggagcctttggcaccgcccctcgacccggagacggacgagcccatggagtcagag
aagctgctccgcatcttcgcatctgagttggtgaagcaggaaatgagcatggagcgatac
atcgatattccaaagaaagttcgtgagctctacgctaaaataggccgtccaacgcccctc
ttcagggcgacgaatctcgaaaaggccctcgaaacgccggcgaggatatacttcaaatac
gaaggggctaccgtaacgggcagccacaagataaacaccgcattggcccaggcatactac
gcgaagaagcagggcatcgagaggctcgtaacagagacaggtgcaggccagtggggaact
gccctgtctctggcaggggcactaatggggataaacgttcgtgtttacatggctagggcc
agcttttaccagaagccctacaggaagactataatgcgtctctacggtgccgaaatctat
cccagtccaagcgacaggaccgagataggaaggaagttcctgagcgaagacccaaaccac
ccaggtggcttgggaatagcgataagcgaagctatcgaggacgttctaagggacgaaaaa
gcgcgctacgccctcggaagcgtgctcaaccacgttttaatgcaccagacggtcataggc
ctagaagccaaagagcagatgaaggagtttgaggatccagatgtcataattggctgcgtt
gggggaggaagcaacttcgcaggcctggcatatcccttcgtcaaggatagactagacggc
aaagctgactacgagttcatagcggttgagccaagggcggcaccgagcatgacgcgcggc
gtttacacctacgactacggcgactctggagggctaacgccgaagatgaagatgcacacc
ctcggccacacctactacgtcccgccgatacacgctggcggcctgaggtaccacggcctg
gctccaacgctcagtattctgataaaccacgggatagttaggccagtagcctaccatcag
acggaggtcttcgaggcggcccggctctttgccaagacggaaggcatagtcccagcaccc
gagagcgcccacgcggtcaaggctgcaatagacagggccctcaaggcgaaggaagaaggt
aaggaagaagtcatcctcttcaacctcagcggccacggcctgctcgacctcaagggctac
gaggatttcctcgacggaaagctcgaggactacgagccagaagagcttccagctttgagg
ggggaggtttag

DBGET integrated database retrieval system