KEGG   Thermococcus onnurineus: TON_0147Help
Entry
TON_0147          CDS       T00789                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ton  Thermococcus onnurineus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TON_0147
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TON_0147
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TON_0147
Enzymes [BR:ton01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TON_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(121958..123289)
Genome map
AA seq 443 aa AA seqDB search
MKAVLPDSKMPKRWYNILPDLPEPLAPPLDPETDEPMESEKLLRIFASELVKQEMSMERY
IDIPKKVRELYAKIGRPTPLFRATNLEKALETPARIYFKYEGATVTGSHKINTALAQAYY
AKKQGIERLVTETGAGQWGTALSLAGALMGINVRVYMARASFYQKPYRKTIMRLYGAEIY
PSPSDRTEIGRKFLSEDPNHPGGLGIAISEAIEDVLRDEKARYALGSVLNHVLMHQTVIG
LEAKEQMKEFEDPDVIIGCVGGGSNFAGLAYPFVKDRLDGKADYEFIAVEPRAAPSMTRG
VYTYDYGDSGGLTPKMKMHTLGHTYYVPPIHAGGLRYHGLAPTLSILINHGIVRPVAYHQ
TEVFEAARLFAKTEGIVPAPESAHAVKAAIDRALKAKEEGKEEVILFNLSGHGLLDLKGY
EDFLDGKLEDYEPEELPALRGEV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttctgccagattccaaaatgccaaagaggtggtacaacatcctgccagac
ctaccggagcctttggcaccgcccctcgacccggagacggacgagcccatggagtcagag
aagctgctccgcatcttcgcatctgagttggtgaagcaggaaatgagcatggagcgatac
atcgatattccaaagaaagttcgtgagctctacgctaaaataggccgtccaacgcccctc
ttcagggcgacgaatctcgaaaaggccctcgaaacgccggcgaggatatacttcaaatac
gaaggggctaccgtaacgggcagccacaagataaacaccgcattggcccaggcatactac
gcgaagaagcagggcatcgagaggctcgtaacagagacaggtgcaggccagtggggaact
gccctgtctctggcaggggcactaatggggataaacgttcgtgtttacatggctagggcc
agcttttaccagaagccctacaggaagactataatgcgtctctacggtgccgaaatctat
cccagtccaagcgacaggaccgagataggaaggaagttcctgagcgaagacccaaaccac
ccaggtggcttgggaatagcgataagcgaagctatcgaggacgttctaagggacgaaaaa
gcgcgctacgccctcggaagcgtgctcaaccacgttttaatgcaccagacggtcataggc
ctagaagccaaagagcagatgaaggagtttgaggatccagatgtcataattggctgcgtt
gggggaggaagcaacttcgcaggcctggcatatcccttcgtcaaggatagactagacggc
aaagctgactacgagttcatagcggttgagccaagggcggcaccgagcatgacgcgcggc
gtttacacctacgactacggcgactctggagggctaacgccgaagatgaagatgcacacc
ctcggccacacctactacgtcccgccgatacacgctggcggcctgaggtaccacggcctg
gctccaacgctcagtattctgataaaccacgggatagttaggccagtagcctaccatcag
acggaggtcttcgaggcggcccggctctttgccaagacggaaggcatagtcccagcaccc
gagagcgcccacgcggtcaaggctgcaatagacagggccctcaaggcgaaggaagaaggt
aaggaagaagtcatcctcttcaacctcagcggccacggcctgctcgacctcaagggctac
gaggatttcctcgacggaaagctcgaggactacgagccagaagagcttccagctttgagg
ggggaggtttag

DBGET integrated database retrieval system