KEGG   Thermococcus onnurineus: TON_0166Help
Entry
TON_0166          CDS       T00789                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ton  Thermococcus onnurineus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TON_0166
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TON_0166
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TON_0166
Enzymes [BR:ton01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TON_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
144066..145400
Genome map
AA seq 444 aa AA seqDB search
MFVRCPSCWRLYSSLIPPTCSCGEPLRIAYDYENVDVSRWRNRDKGVWRYRELLPDVNEI
ISLHEGGTPLLRAKLGEELGLNVFIKDETRNPTGSFRDRLITVAVSYGLPHAENGFVVAS
NGNAAASLAAYAARAGKEAYTVVPKLIEKCKLTQIVAFGAKIIRYGESVDEGISYAEGLA
EGKGLYNITPESNLIGLEGQKTVAFELWEELNPTHVIVPTGSGSNLYSIYKGFRELLEIG
VIEEMPKLIAVQTERCSPIASEVLGVEPKAEPTKALALYVKNPLTKELALEAIRETDGTA
VLVGEDELDLGERLLAKEGIFAEYASVVIVPALLKLAEEGYFERDDRIALIVTSSGLKGH
YSEGREKFTLGGTKLEILKLLSERSMYGYEIWEALEKPLKYQAVYQHLRELESLGLIEES
HKKGRRVYYGLTEKGRKFLETLSA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttaggtgtccctcctgctggaggctctattcttctcttattccccccacgtgc
tcctgcggcgagccacttaggatagcctacgactacgagaatgttgatgtgtcaagatgg
cgaaacagggataagggcgtctggcgctacagggagcttctgccagacgttaatgagatt
atcagcctccacgagggtggaacgcctcttctgagagccaaacttggtgaggaactcgga
ctaaacgtcttcatcaaggatgaaacgaggaacccgaccggctccttcagggacaggctc
atcactgttgccgtttcctatggcctaccccatgctgagaacggtttcgtcgttgccagc
aacgggaacgcggcggcttccctcgcggcctatgcagccagagctggcaaagaggcctac
acggtagtccccaagctcatagagaagtgcaagctaactcagattgttgcctttggggcc
aaaatcatacgctacggcgagagcgttgacgagggcataagctacgctgaggggctggcc
gaaggtaagggcctgtacaacatcacccccgagagcaacctgattggtcttgagggccag
aaaacggtggctttcgagctctgggaggagctcaaccctacccatgtgatagtgcctact
ggaagcggcagcaacctttacagcatctacaaaggttttagggaactcctagagattggc
gtaatcgaggagatgcccaagctcatagcagttcaaactgagagatgctcccctatagcg
agcgaggttctcggcgttgagcctaaggccgagccgaccaaagctctggctctctacgtc
aagaaccccctcacgaaagagctcgcccttgaggctatacgggagacggacggaactgca
gtcctcgttggggaagacgagcttgatttgggcgagaggctcctcgcgaaggagggtatc
tttgccgagtacgcttcggtggtaatagttccggcactcctcaagctcgccgaggagggc
tattttgagagggacgacagaatagccctaatcgtgacgagctccggattaaaaggccac
tattcggagggcagggaaaagttcacccttgggggaaccaagctcgaaatcctaaagctg
ctcagcgaaaggagcatgtatggctacgagatatgggaagcactggagaagcccctcaag
tatcaggccgtctatcagcacctgcgcgagctcgaaagcctcggtctcatagaggaatct
cacaagaagggacggcgcgtgtactacgggctcacggagaagggtaggaagttcctcgag
acgctctctgcctaa

DBGET integrated database retrieval system