KEGG   Thermococcus onnurineus: TON_0202Help
Entry
TON_0202          CDS       T00789                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ton  Thermococcus onnurineus
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179650..181131
Genome map
AA seq 493 aa AA seqDB search
MDRFILSLDEGTTSARAIIFDRESNVLGVGQYEFPQHYPRPGWVEHDPNEIWEAQFRAIK
TAIERAKIEPTQIAAIGVTNQRETTIVWDKSGKPLHNAIVWQCRRTAEMVEEIKREYSEV
IKEKTGLVPDAYFSASKLKWLLDNVPGLREKAEKGEVLFGTVDTFLIYRLTGEHVTDYSN
ASRTMLFNIKKLEWDDELLEIFGVPEGVLPEVKESSEIYGYTKKELLGAEIPVSGDAGDQ
QAALFGQAAFETGMVKATYGTGNFILANTGKTVRYSDNLLTTVAWGLNGKVSYALEGSVF
ITGAAVQWLRDGIKIIKSAPETEELARKLQSNEGVYFVPAFVGLGAPYWDQFARGLIIGI
TRGTGREHLARATLEAIAYLTRDVVEEMERLVGIKELRVDGGATANDFLMQFQADILNRR
VVRPVVKETTALGAAYLAGLAVDYWEGLEEIKSLWKAEKVFGPVMDEETRRKLYRGWKEA
VKRAMGWAKVVDA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggacaggttcattctctcgcttgatgagggaactacctcagccagggccataatcttc
gacagggagagcaacgttctcggcgttggtcagtacgagtttccccagcactatcccaga
cctggctgggtcgagcacgacccgaacgagatatgggaggcccagttcagggcgataaag
accgctatcgaacgggccaaaatcgagccaactcagatagcggcgataggcgttaccaac
cagcgcgagacgacgatagtctgggataaaagcggaaagccgctccacaacgcgatagtc
tggcagtgcagaagaaccgctgagatggtcgaagaaataaagcgggaatacagcgaggtc
atcaaggagaagacagggttagttccggatgcttatttctcggccagcaagcttaagtgg
ctcctcgacaacgtgcctggcctaagggagaaggccgagaaaggcgaggttctcttcgga
acggttgacaccttcctcatctaccgcctcacgggcgagcatgttacggattactcaaac
gcatccaggacaatgctcttcaacatcaagaagctcgaatgggacgacgagcttctcgaa
atttttggggttcccgagggcgtcctgcccgaagtcaaagagtcgagtgaaatctacggt
tacacaaagaaagaacttctcggtgctgaaattcccgtgagtggcgacgcgggcgaccag
caggcagctctgttcggccaggccgcctttgagacgggcatggttaaggcaacatacgga
accggaaactttatcctggccaacactggcaagaccgtccgctattcagataacctgctc
accacggtagcgtgggggttaaatggaaaagtctcctatgcccttgaggggagcgtcttc
ataacaggggcggcagttcaatggctccgcgacggaatcaaaatcataaagagcgcgccg
gagacggaggaactcgcccggaagctgcagagtaacgagggggtttacttcgttcctgcc
ttcgttggccttggagccccttactgggatcagttcgcgagggggctgataattggcata
acgcgcggaactggtagggagcatctcgccagggcgacgctggaagccatagcctacctg
acgcgcgacgtggtcgaggagatggagagactcgtggggataaaggagctccgcgtcgat
gggggagcaacagcgaacgacttcctgatgcagttccaggcggatatactcaacaggagg
gtcgtcaggcccgtcgtgaaggaaactactgccttgggggcggcgtatttggcgggactg
gccgtcgattactgggagggcctcgaagaaataaagagtctgtggaaggcagagaaggtc
ttcgggccagtgatggacgaagaaacccgcaggaagctctaccgcggctggaaggaagca
gtaaagagggctatgggctgggccaaggttgtggatgcttga

DBGET integrated database retrieval system