KEGG   Thermococcus onnurineus: TON_0369Help
Entry
TON_0369          CDS       T00789                                 

Definition
(GenBank) deblocking aminopeptidase
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
ton  Thermococcus onnurineus
Brite
Enzymes [BR:ton01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     TON_0369
Peptidases [BR:ton01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   TON_0369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(342852..343889)
Genome map
AA seq 345 aa AA seqDB search
MVNIELLKKVVEAPGVSGYEFLGIRDVVIEALKDYVDEIYVDKLGNVIAHKKGNGPKIMI
AAHMDKIGIMVNHIDKEGYLHVVPVGGVDPRTLVAQRIRFFTEKGERFGVVGHIPPHLQK
PEDRKKAANWDTIVVDVGADSKEEAEEMGFKVGTIGEFAPAFTQLNENRVATPYLDDRVC
LYAMIETARAIENHEADIYFVASVQEEVGLRGARVASYAIDPEIGIAMDVTFAKQVGDKG
RIVPKLGGGPVMDVGPNINPKIRTFADEIAKKYEIPLQVEASPRPTGTDANIMQINREGV
ATAVLSIPIRYMHSQVETADLRDIDLTVKLAKYMLEELRPMDLTP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatattgaacttttgaagaaggtcgtcgaagctccaggtgtttccggttacgaa
tttctcggaataagagatgttgttattgaggctctgaaggactacgtcgatgaaatctac
gtcgacaagctcggcaacgttatagcccacaagaagggtaatggaccaaagataatgatc
gccgcccacatggacaagataggcatcatggtaaaccacatcgacaaggaaggctacctc
cacgtcgtccccgttggcggtgttgacccgaggactctggttgcccagaggattcgcttc
tttaccgagaagggcgagcgctttggagtggtcggccacataccgccgcatctccagaag
cccgaagacaggaagaaggcggcgaactgggacaccattgttgtggacgtcggtgccgac
agcaaggaagaggccgaagagatgggcttcaaggttggaaccattggcgagtttgcccca
gctttcacccagctcaacgagaacagagttgcaacgccctaccttgacgaccgtgtctgc
ctttacgcgatgattgagactgccagagccatcgagaatcatgaggcggacatatacttc
gtggccagcgttcaggaagaggtcggcctcaggggtgcgagggttgccagctacgccatc
gatccggagattggtatcgctatggacgtcaccttcgccaagcaggtcggtgacaagggc
aggatagttcccaagctcggtggcggtccggttatggacgttgggccaaacattaacccc
aagataaggacctttgccgatgagattgccaagaagtacgagataccactccaggtcgag
gcctccccaaggccaaccggaacggacgccaacataatgcagataaaccgcgagggcgtc
gcaactgcagttctgagcataccgataaggtacatgcacagccaggtcgagaccgctgac
cttagggacatcgacctcacggtaaagctcgccaagtacatgcttgaggagctcagacca
atggacctcactccatga

DBGET integrated database retrieval system