KEGG   Thermococcus onnurineus: TON_0369Help
Entry
TON_0369          CDS       T00789                                 

Definition
deblocking aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ton  Thermococcus onnurineus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ton00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(342852..343889)
Genome map
AA seq 345 aa AA seqDB search
MVNIELLKKVVEAPGVSGYEFLGIRDVVIEALKDYVDEIYVDKLGNVIAHKKGNGPKIMI
AAHMDKIGIMVNHIDKEGYLHVVPVGGVDPRTLVAQRIRFFTEKGERFGVVGHIPPHLQK
PEDRKKAANWDTIVVDVGADSKEEAEEMGFKVGTIGEFAPAFTQLNENRVATPYLDDRVC
LYAMIETARAIENHEADIYFVASVQEEVGLRGARVASYAIDPEIGIAMDVTFAKQVGDKG
RIVPKLGGGPVMDVGPNINPKIRTFADEIAKKYEIPLQVEASPRPTGTDANIMQINREGV
ATAVLSIPIRYMHSQVETADLRDIDLTVKLAKYMLEELRPMDLTP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatattgaacttttgaagaaggtcgtcgaagctccaggtgtttccggttacgaa
tttctcggaataagagatgttgttattgaggctctgaaggactacgtcgatgaaatctac
gtcgacaagctcggcaacgttatagcccacaagaagggtaatggaccaaagataatgatc
gccgcccacatggacaagataggcatcatggtaaaccacatcgacaaggaaggctacctc
cacgtcgtccccgttggcggtgttgacccgaggactctggttgcccagaggattcgcttc
tttaccgagaagggcgagcgctttggagtggtcggccacataccgccgcatctccagaag
cccgaagacaggaagaaggcggcgaactgggacaccattgttgtggacgtcggtgccgac
agcaaggaagaggccgaagagatgggcttcaaggttggaaccattggcgagtttgcccca
gctttcacccagctcaacgagaacagagttgcaacgccctaccttgacgaccgtgtctgc
ctttacgcgatgattgagactgccagagccatcgagaatcatgaggcggacatatacttc
gtggccagcgttcaggaagaggtcggcctcaggggtgcgagggttgccagctacgccatc
gatccggagattggtatcgctatggacgtcaccttcgccaagcaggtcggtgacaagggc
aggatagttcccaagctcggtggcggtccggttatggacgttgggccaaacattaacccc
aagataaggacctttgccgatgagattgccaagaagtacgagataccactccaggtcgag
gcctccccaaggccaaccggaacggacgccaacataatgcagataaaccgcgagggcgtc
gcaactgcagttctgagcataccgataaggtacatgcacagccaggtcgagaccgctgac
cttagggacatcgacctcacggtaaagctcgccaagtacatgcttgaggagctcagacca
atggacctcactccatga

DBGET integrated database retrieval system