KEGG   Thermococcus onnurineus: TON_0444Help
Entry
TON_0444          CDS       T00789                                 

Definition
tungsten-containing oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ton  Thermococcus onnurineus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TON_0444
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TON_0444
Enzymes [BR:ton01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TON_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
414910..416766
Genome map
AA seq 618 aa AA seqDB search
MYGYHNRIARVNLSKGKVTYEKLDDETIRKFIGGKGLGYYIIYREVPPGTDPLSPANKLV
FAPGGMTGLVPGSSKVIAVSKSPETGLISDSSGGDAFGPKLKGHFDALIIEGKAEEPVYL
YIHDGEVEIRDAEGLWGRGTYEVAKEIWKEHPKASMAMIGPAGEKTARIANIIYDTERAS
GRGGLGAVLGSKKVKAVIVEPGQKPNVAHPEEFQRLWKEFYSEFATNPKYGHTRNYGTTD
ALRSSASLGMSPAYNFSRPYISDELASKLAGDEVKKYEIEPEWFVHGKSCPIKCARYVEV
EYKGRKIRVKPEYESIAMLGAATGVFNFPAVAYFNWLANNLGLDSIAAGATIAWLFEMVE
RGLIGEDEIGFPVKGWGDEEAEEKLLKLMAERKGIGAILADGVKRACERLGRGCEFAVHV
KGMESPAWDPRGRRTYALSYATADVGASHLRGWPRPHQLPNQGPAKELVPSLIEGRDESY
ITDMLGVCKFVPYKMEDLARLYSIVTGEEWTVERLRKVAQAVESIARIHDALDWITPPYD
DTIPPRWWEPEPEGPAEGNAAFIDYNDFLEARREFYRLRGWHEELGVPLPETMEELGYPE
FKSDAERALETVKKRMES
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtatggctaccacaacaggatagcacgggtgaacctgagcaaaggtaaggtaacctac
gagaagcttgacgacgagacgatcaggaagttcataggaggaaaggggcttggctactac
atcatctaccgtgaggttccgccgggaaccgatccgctcagcccggcgaacaagcttgtc
ttcgctccaggaggaatgacgggcttagttccgggctcgagtaaggtcatagccgtgagc
aagagcccagagactgggttaataagcgactccagcggtggagacgccttcgggcccaag
ctcaagggccacttcgacgccctgataatcgaggggaaggcagaggagccagtatacctc
tatatccatgatggtgaggtcgagataagggacgccgaaggcctgtggggcagagggact
tacgaagttgctaaggaaatctggaaggagcacccaaaggccagcatggccatgataggg
cccgctggagaaaaaactgccaggatagcgaacataatctacgacaccgagagggccagt
ggaaggggcggtcttggcgcggttcttggaagcaagaaggttaaggcagtcattgtggag
ccgggccaaaaaccgaatgttgctcatccggaagagtttcagcggctctggaaggagttc
tacagtgagttcgccaccaatccgaagtacgggcacacgaggaactacggaaccaccgat
gccctcaggagctcggcgagcctcggcatgagtcctgcctacaacttctcgaggccttac
atctcggacgagctggcgagcaaattagcgggcgacgaggtcaagaagtatgagatcgag
ccggaatggttcgtgcacggcaagagctgtccgataaagtgcgctcgctacgtcgaggta
gaatacaaggggaggaagatacgcgtcaagcccgaatacgagagcatagccatgctcgga
gcagcaacgggagtcttcaacttcccggctgttgcgtacttcaactggcttgccaacaac
ctcgggctggacagtatagcagccggagctacaatagcgtggctcttcgagatggtcgag
aggggcctaatcggcgaggacgagataggtttccccgttaaaggctggggtgacgaagag
gccgaagagaagctcctcaagctcatggccgagaggaagggcatcggtgcgatccttgcc
gatggagtaaagcgtgcctgcgaaaggctcggaaggggctgcgagtttgcagtccacgtc
aagggcatggagtcaccggcctgggacccgcgtggaaggagaacctacgccctgagctac
gctacagccgacgtcggagcgagccacctgaggggctggccgaggccgcatcagctgccc
aaccaggggccagctaaggagctcgtgccgtcccttatcgagggcagggatgagagctac
atcaccgacatgctcggcgtctgtaagttcgtgccctacaagatggaagacctagcgagg
ctctacagcatcgtcactggcgaggagtggacggtcgagaggctgaggaaagttgcccaa
gcggtggagagcatcgccagaatccacgacgccctcgactggatcacgccgccgtacgac
gataccataccgccgcgctggtgggagcccgagcctgaggggccagcggaaggcaacgcg
gccttcattgattacaacgactttcttgaggccagaagggagttctacaggctgagaggc
tggcacgaggagcttggcgtcccgctacctgagacgatggaagagcttggctatccggag
ttcaagagcgatgctgagagggctttggagacagtgaagaaaagaatggaaagctga

DBGET integrated database retrieval system