KEGG   Thermococcus onnurineus: TON_0880Help
Entry
TON_0880          CDS       T00789                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ton  Thermococcus onnurineus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ton01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ton00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
808596..809729
Genome map
AA seq 377 aa AA seqDB search
MDFELESYVAGILRDIRERGIEAVKEYSKKFDGYEGEFLVSEEEFEEAERLIPEKDKEII
KRTIERIRFYHEKQLENDKLYIKNASLYGIIYKPIRRIGIYVPGGKPLPSTLMMVGVPAK
IAGVKEIAVTIPPKNGKVNPYVLYVAKLLGIKEVYKLGGIQAIGAMAYGIGMKKVDKIFG
PGNKFVNEAKRQVFGVVGIDSLAGPSEIAVIADESANKEYVLYDLLSQLEHGKDSKAWLL
TTSRELAEYCNRDGIEVVLCKSLEECAEKANEIAPEHLEIITENPMGLVDLIDNAGAIYL
GEYTPVPAADYFLGVNHVLPTGGAAKFSGVLTVMDFMKRISLAYVSREEFLAERYLGIRL
AEIEGLEMHKRSMEVRR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggattttgagctggaaagctacgtggctggaattttgagggatataagggagaggggc
atcgaagcggtgaaggaatactcaaagaagttcgacggctacgagggcgaattcctggta
agtgaggaggagttcgaagaagctgagaggctgattccagaaaaagacaaggagatcatc
aagcgtacaatagagagaatccgcttttaccacgagaagcagcttgagaacgataagctc
tacataaagaacgcctcgctttacggcataatctacaagccaattaggaggataggaatc
tatgtcccaggaggaaagcctctgccctcgacgctcatgatggtcggggttccggcaaaa
atagcgggcgttaaggagatagcggttacaataccacccaaaaatggcaaagttaacccc
tacgtcctctacgtggcaaagctcctcggcattaaagaggtctacaagctcggcgggatt
caggcgattggagcaatggcttatggcattggcatgaagaaagtagacaaaatctttggt
ccgggcaacaagttcgtgaacgaggcaaagaggcaggttttcggtgttgtgggaattgac
agcttggctggaccgtcggagatagcagttatagccgatgagagcgcaaacaaagaatac
gtcctctacgatttactctcccagcttgagcacggaaaggacagcaaggcctggctcctg
acgacttcaagagagctggcagagtactgcaacagggacgggatcgaggtcgttctctgt
aagagccttgaggaatgcgccgaaaaggctaacgagatagctccggagcacttggaaata
atcaccgagaacccaatgggactggttgacctcatagacaacgcgggagcgatatacctc
ggggagtacacgccagtgccagcggctgactacttcctcggcgtcaaccacgtccttccg
acgggaggagcagcgaagttcagcggagttttaacagttatggacttcatgaagaggatt
agcttagcctacgtcagcagagaggagttcttggcggagagatatctaggaattcgcctg
gccgaaattgaaggacttgagatgcacaaaaggagcatggaggttagaagatga

DBGET integrated database retrieval system