KEGG   Thermococcus onnurineus: TON_1062Help
Entry
TON_1062          CDS       T00789                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ton  Thermococcus onnurineus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TON_1062
Enzymes [BR:ton01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     TON_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
978673..980184
Genome map
AA seq 503 aa AA seqDB search
MKAKVRILDMYSGRYSVFINEKEAKKAKLHPDDLVKLETGKKTVYGSVTISNLVKEGEIG
ISKDVLQLHNFSEGEVVTVLPSGAPESVRYIKKKMNGEKLRKVEIETIVKDIVDRKLRDI
EISSFVTALEINGLDMDEIAALTIAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVFAEVSFSLDEIKRIVEKIGACMVWGGALNLA
PADDITIKAERALSIDPVGLMLASIMSKKYAMGSQYVLIDIPTGKGVKVETVDEARALAR
DFIELGKRLGQYVEVAITYGGQPIGHTVGPALEAREALQALMSGTGPGSLIEKATGLAGI
LLEMGGVAPSGMGKKMAREILESGKAYQKMREIIEEQGGNPDIKPEEIPIGDKTYTFTAP
TSGYITAIDNKAITGIARAAGAPEDKGAGIELYVKVGEKVKEGDPLFTIYAESEARLDQA
IVFARRAEPIRIEGMVLQRIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgaaggttaggatactggacatgtacagcgggaggtattcggtgtttatcaat
gagaaagaggcgaagaaagcaaagctccacccggatgaccttgttaagcttgagacaggg
aagaagactgtatacggcagcgtcaccataagcaacctcgtgaaagaaggtgaaatcgga
atcagcaaagatgtactccaactccacaacttttccgagggagaggtcgttacggtgcta
cccagcggggcccctgagagcgtccgctatataaagaagaagatgaacggcgaaaagctc
aggaaggtcgagattgagaccatagtcaaggacatcgttgataggaagctgcgcgacatc
gagataagctccttcgtcactgcccttgagataaatggcctcgacatggacgagatagca
gccctgaccatagccatggcagagaccggcgacatgctcgacatagacaggaagcccatc
atggacgtccacagcattggcggtgtcccaggaaacaagaccaacatcctagttgtcccg
atagttgcagcggcaggccttaccataccaaagacatcttcgagggccatcaccagcgcc
gcaggaacggccgatgttgtcgaggtttttgcagaggtcagcttcagtctagacgagata
aagagaatagtcgaaaagataggtgcttgtatggtctggggtggcgcgctcaacctcgct
ccagcagatgatattaccattaaagccgagcgcgcgctgagcatcgatccggtcggcctc
atgctggcgagcataatgtcaaagaaatacgctatgggtagccagtacgtccttatagac
atcccgaccggaaagggtgtcaaggtagagaccgttgacgaagcccgtgcactggcaaga
gacttcatagagctcggaaagaggctcggccagtacgttgaggtcgcgataacctacggt
ggccagccgataggccacaccgttggccccgccctcgaggccagagaggcgcttcaagca
ctgatgagcggaaccggtcctggaagcctcatagagaaggcgacaggcctggctggaatc
ctcctcgagatgggcggtgttgctccatcaggaatgggtaagaagatggcgcgtgagata
ctcgagagcggaaaggcctaccagaagatgcgtgaaatcatagaggagcagggcggaaac
ccggacatcaagccggaggaaataccgataggtgacaagacctacacctttaccgcacca
acgagcggctacatcaccgcaatagacaacaaggcgataaccggaatcgcaagggccgcc
ggagcgccggaggacaagggcgccggaatagagctctacgtcaaagttggcgagaaggtc
aaggaaggcgacccactattcactatatacgccgagagcgaggctaggctcgaccaggcg
atagtcttcgccagaagggcagagccgataaggatcgagggaatggtgctccagcgaatc
ggcaacatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system