KEGG   Thermococcus onnurineus: TON_1062Help
Entry
TON_1062          CDS       T00789                                 

Definition
(GenBank) Thymidine phosphorylase
  KO
K18931  AMP phosphorylase [EC:2.4.2.57]
Organism
ton  Thermococcus onnurineus
Brite
Enzymes [BR:ton01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     TON_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYNP_C Glycos_transf_3 Glycos_trans_3N DUF2254 CDC48_N Biotin_lipoyl Biotin_lipoyl_2 Molydop_binding HlyD_D23 FeoA
Motif
Other DBs
NCBI-ProteinID: ACJ16550
UniProt: B6YWT7
Position
978673..980184
Genome map
AA seq 503 aa AA seqDB search
MKAKVRILDMYSGRYSVFINEKEAKKAKLHPDDLVKLETGKKTVYGSVTISNLVKEGEIG
ISKDVLQLHNFSEGEVVTVLPSGAPESVRYIKKKMNGEKLRKVEIETIVKDIVDRKLRDI
EISSFVTALEINGLDMDEIAALTIAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVFAEVSFSLDEIKRIVEKIGACMVWGGALNLA
PADDITIKAERALSIDPVGLMLASIMSKKYAMGSQYVLIDIPTGKGVKVETVDEARALAR
DFIELGKRLGQYVEVAITYGGQPIGHTVGPALEAREALQALMSGTGPGSLIEKATGLAGI
LLEMGGVAPSGMGKKMAREILESGKAYQKMREIIEEQGGNPDIKPEEIPIGDKTYTFTAP
TSGYITAIDNKAITGIARAAGAPEDKGAGIELYVKVGEKVKEGDPLFTIYAESEARLDQA
IVFARRAEPIRIEGMVLQRIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgaaggttaggatactggacatgtacagcgggaggtattcggtgtttatcaat
gagaaagaggcgaagaaagcaaagctccacccggatgaccttgttaagcttgagacaggg
aagaagactgtatacggcagcgtcaccataagcaacctcgtgaaagaaggtgaaatcgga
atcagcaaagatgtactccaactccacaacttttccgagggagaggtcgttacggtgcta
cccagcggggcccctgagagcgtccgctatataaagaagaagatgaacggcgaaaagctc
aggaaggtcgagattgagaccatagtcaaggacatcgttgataggaagctgcgcgacatc
gagataagctccttcgtcactgcccttgagataaatggcctcgacatggacgagatagca
gccctgaccatagccatggcagagaccggcgacatgctcgacatagacaggaagcccatc
atggacgtccacagcattggcggtgtcccaggaaacaagaccaacatcctagttgtcccg
atagttgcagcggcaggccttaccataccaaagacatcttcgagggccatcaccagcgcc
gcaggaacggccgatgttgtcgaggtttttgcagaggtcagcttcagtctagacgagata
aagagaatagtcgaaaagataggtgcttgtatggtctggggtggcgcgctcaacctcgct
ccagcagatgatattaccattaaagccgagcgcgcgctgagcatcgatccggtcggcctc
atgctggcgagcataatgtcaaagaaatacgctatgggtagccagtacgtccttatagac
atcccgaccggaaagggtgtcaaggtagagaccgttgacgaagcccgtgcactggcaaga
gacttcatagagctcggaaagaggctcggccagtacgttgaggtcgcgataacctacggt
ggccagccgataggccacaccgttggccccgccctcgaggccagagaggcgcttcaagca
ctgatgagcggaaccggtcctggaagcctcatagagaaggcgacaggcctggctggaatc
ctcctcgagatgggcggtgttgctccatcaggaatgggtaagaagatggcgcgtgagata
ctcgagagcggaaaggcctaccagaagatgcgtgaaatcatagaggagcagggcggaaac
ccggacatcaagccggaggaaataccgataggtgacaagacctacacctttaccgcacca
acgagcggctacatcaccgcaatagacaacaaggcgataaccggaatcgcaagggccgcc
ggagcgccggaggacaagggcgccggaatagagctctacgtcaaagttggcgagaaggtc
aaggaaggcgacccactattcactatatacgccgagagcgaggctaggctcgaccaggcg
atagtcttcgccagaagggcagagccgataaggatcgagggaatggtgctccagcgaatc
ggcaacatctga

DBGET integrated database retrieval system