KEGG   Thermococcus onnurineus: TON_1083Help
Entry
TON_1083          CDS       T00789                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ton  Thermococcus onnurineus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ton00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002918..1004360
Genome map
AA seq 480 aa AA seqDB search
MCLVAGGIGTNLKEHFTMMILAGKHRGEDSFGVWTNEGVLKSEDFSKLDEIPDGRIGLLQ
CRLAMTGSFGYTQPFYNDLALVHNGEIYNHNHIRNYLKDRGVSFESDVDSEVILRLLEYL
LEKGLNVETAVKKAMSMLEGDYAVAFSDGRRIYLFRDPVGVRPLYYSPNGFFASEKKVLW
AIGERAIPVQPGELILLSREGAQRRKLFSILELKRMVFSEERAKLSLIRTLTHAVRVRVE
KRTGVLFSGGLDSSLIALTASRYSDVVLYTAGAEGSQDLEWARKVSEELGLPLREYVFDL
DDVKEAVPKVAFAIEESNPMNLAIGIPLYFATKLAREDGCKLLLSGQGADELFGGYAKYL
ERPELMESDLLEIGEKNLVRDDKIAMLNSVEGRVPFLDLAVISTAFNTPPEAKIRKGIRK
AILREVAVELGLPKWIAERDKKAAQYGSGAQKLLKKLAKSEGMTLREYAQRAFNEAFKRG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcttgtagcgggaggaatcggaaccaacctcaaggaacactttacaatgatgatt
cttgctggaaagcacagaggagaggactcttttggtgtgtggactaacgaaggagtgctc
aaatcagaggacttttcgaagcttgatgaaattcccgacggaagaatcggcctccttcag
tgcaggctggccatgaccggttccttcggttacacccagcccttctacaacgatctggcg
cttgtccataacggtgagatatacaatcacaaccatattcggaactacctcaaggacagg
ggggtctccttcgagagcgacgttgacagcgaagtgatcctaaggcttctcgaatatctc
ttggagaagggccttaatgttgagacagctgttaaaaaggccatgagcatgctagaaggg
gactacgcagttgccttcagtgatggcaggagaatatacctcttccgcgaccccgttggt
gtgaggcctctctactattcaccgaacggcttcttcgcctcggagaaaaaggtgctctgg
gcgattggtgagcgggccattccagttcagccgggagagctgatcctcctgtcgcgtgaa
ggggctcaaaggagaaagctcttcagtatacttgaactaaaaaggatggttttttctgag
gaaagagcaaaactctctctaataaggacgctcacccatgccgtacgggttagagtcgaa
aagaggacgggggttctcttctccggcggtctggacagctcgctaatagctctgactgca
tcgaggtactcggatgtcgtcctctacaccgccggagctgagggaagtcaggatctcgaa
tgggctaggaaggtcagcgaagagcttggtcttccacttagggagtatgtttttgatctg
gacgacgtcaaggaggccgttccaaaagttgccttcgccatagaggaatcgaacccaatg
aacctagcaataggtattcctctctacttcgctaccaaactcgcccgtgaagatggctgc
aagcttcttctgagcggtcagggagccgacgagctcttcggcggttacgcaaaatacctc
gagaggccagaactcatggagagcgatctgcttgaaataggtgagaaaaaccttgtcagg
gacgataagatagcgatgctgaattccgtggaaggaagggttcccttccttgatctggca
gtgatttcaacagccttcaacacgccccccgaggccaagataaggaagggcatcagaaaa
gcgatcctcagggaagttgccgtggagcttggtcttccgaagtggatagctgagagggac
aaaaaggccgctcagtatggcagcggtgctcagaagctcctcaagaagctcgccaagagc
gaaggaatgaccctcagagagtacgcccaaagagcctttaatgaggcatttaaacgcgga
taa

DBGET integrated database retrieval system