KEGG   Thermococcus onnurineus: TON_1097Help
Entry
TON_1097          CDS       T00789                                 

Definition
acetyl-CoA synthetase I subunit alpha
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
ton  Thermococcus onnurineus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TON_1097
   00620 Pyruvate metabolism
    TON_1097
   00640 Propanoate metabolism
    TON_1097
Enzymes [BR:ton01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     TON_1097
Lipid biosynthesis proteins [BR:ton01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TON_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1017809..1019194)
Genome map
AA seq 461 aa AA seqDB search
MSLEALFRPKSIAVIGASEKPGKIGYAVMKNLVEYGYEGKIYPVNVKGVEIEINGRKFKS
YKSILDVPDDVDMAVVVVPARFVPQVVEECGKKGVKVLPIISSGFGELGEEGKKIERQLV
ETANKYGMRILGPNIFGVVYTPAKMNATFGPTDVMPGNLALISQSGALGIALMGWTILEK
VGLSAVVSVGNKSDIDDADLLEFFKTDDNTKAILIYMEGVKDGRRFMEVAKEVSMEKPII
IIKAGRSERGAKAAASHTGSLAGADKIYEAAFKQSGVLRALTIGEAFDWARTLSNLPEPE
GENLVILTNGGGIGVMATDAAEEEGLHLYDNLEDLKVFANHMPPFGSYKNPVDLTGMAGA
EAYEGAIRDALANPNMHSIAVLYCQTAVLDPRDLAKIVIREYNESGRKKPLVVAIVGGIE
AKEAIDMLNEEGIPAYPEPERAIKALAALYRWSRWKKRQGE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagaggcactttttaggccaaaaagcatcgccgtcatcggagcttcagagaag
ccaggtaagataggctacgcagttatgaaaaacctcgtcgaatacggctatgagggcaag
atctaccctgttaatgtcaagggtgtcgagattgagatcaacggcaggaagttcaagtca
tacaagagcatccttgatgttcccgatgacgtcgatatggctgttgtagttgtcccggcc
aggttcgtcccgcaggtcgtcgaggagtgtggcaagaagggcgttaaagttctccccatc
ataagctctggcttcggtgagcttggcgaggagggcaagaagattgagagacagctcgtg
gagaccgccaacaagtacggcatgagaatccttggcccgaacatcttcggcgttgtctac
actccagccaagatgaacgccactttcggcccaaccgatgtcatgccgggtaaccttgcc
ctcatcagccagagcggtgcccttggaattgccctcatgggctggaccatcctcgagaag
gtcggcctttcagccgtcgtcagtgttggaaacaagagcgacatcgacgacgccgacctg
cttgaattcttcaagaccgacgacaacaccaaggccatccttatctacatggagggtgtc
aaggacggaaggcgctttatggaggttgccaaggaagtcagcatggagaagccgattatc
attatcaaggccggaaggagtgagcgtggagccaaggccgcagcttcccacactggttcg
ctcgccggtgctgacaagatatacgaggccgccttcaagcagagcggcgttctgagggcc
ttaaccatcggcgaggcctttgactgggcgagaacgctgagcaacctgccagagccagag
ggcgagaacctcgtcatactcaccaacggcggtggaattggagttatggccaccgacgcc
gctgaggaagagggtctgcacctctacgataacctggaagacctgaaagtcttcgccaac
cacatgccgcccttcggaagctacaagaacccggttgacctcacaggtatggccggcgcg
gaggcctacgagggtgccataagggacgccctggcgaacccgaacatgcacagcatcgct
gtgctctactgccagacggccgtgcttgacccgagggatctcgccaagatagtcatccgc
gagtacaacgagagcggcaggaagaagccactcgtcgttgccatcgtcggcggcatagag
gccaaggaagccatcgacatgctcaacgaggagggcattccagcctatccggagccggag
agggcgataaaggctcttgctgccctctaccgctggagccgctggaagaagaggcaagga
gagtga

DBGET integrated database retrieval system