KEGG   Thermococcus onnurineus: TON_1232Help
Entry
TON_1232          CDS       T00789                                 

Definition
(RefSeq) threonine synthase (TS)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ton  Thermococcus onnurineus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TON_1232
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TON_1232
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TON_1232
Enzymes [BR:ton01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TON_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1123587..1124756
Genome map
AA seq 389 aa AA seqDB search
MFAAKLVCTKCGEEYSLACGVYKCTKCGSPLDVRYHYDDIADLIQDNDPWFREHPHVWKY
WMFLPVSNLKKAVTLNEGGTRLYRAKRLEEKIGISKLYIKNEGENPTGAFKDRGSSVEIT
KALEFHAQKVIVASTGNMAASISAYGAKAGLKVTIVVPEGTPEGKLVQAKMYGANVEVFG
KTYDEALAEAERRALEDGYYLTGNYHYRVEGQKTTGFEIIDQLHFNVPDWIVVPIGAGTH
LRAIWKGLKEFYRIGLISELPRIAGVQIEGYDSIVRAWKTSKPIEKITKKVPTIASAIAV
KAPVDGENVLKAVKESNGYLDTVTNEETAAAGLLLGREGLFVEPSSATSLALAQKMREEG
IIDKGESVVIIATGHGLKDINTWSKVLTS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcagcgaagctggtctgcacaaagtgtggtgaggagtactccctagcatgtgga
gtttataagtgcaccaaatgtggttcacccctagatgttcgctatcattacgacgatata
gcagacctcatccaggataacgacccctggttcagggagcatccgcacgtctggaagtac
tggatgttccttccagtctccaatcttaaaaaagcggttacgctcaatgaaggcggtaca
agactttacagggcaaaaaggcttgaggaaaaaataggcatctcgaagctgtacatcaag
aacgaaggcgagaacccgactggggcttttaaagacagaggctcaagtgtcgaaattaca
aaagccctcgagtttcacgcgcagaaagtgatagtagcttcaaccggcaacatggcggcg
tcaataagtgcatacggggcaaaagctggcctcaaagtcactatagtagttcccgaggga
accccagagggcaagctcgtccaggccaagatgtatggagcaaacgttgaggttttcgga
aagacgtacgatgaagcgctggcagaggcagagagaagggcgcttgaggatggctactac
ctgaccggcaactaccactaccgtgtcgagggacagaagacgacgggctttgaaatcatc
gatcagctccacttcaacgtccccgactggatagtagtgcccataggagccggaacacac
ctcagggcaatctggaagggcctaaaagagttttatcggattggcctcatcagtgagctt
ccaaggatagcgggcgtccaaattgagggctatgactcaatagttagagcttggaagacc
agcaaacccattgaaaagataacaaaaaaggtcccaacaatcgccagtgcaatagccgtc
aaggccccagttgatggagagaacgttctcaaggcagtaaaggagagcaacggatacctc
gatacagttaccaatgaagaaacagccgctgctggccttctcctcggaagggaaggactc
tttgttgagccctcctccgcaacctccctggcccttgctcagaaaatgagggaagaggga
ataatagacaaaggcgaaagcgtagttatcatcgcaaccggccacggactcaaagacatc
aacacctggagcaaagtgctgacgagctaa

DBGET integrated database retrieval system