KEGG   Thermococcus onnurineus: TON_1354Help
Entry
TON_1354          CDS       T00789                                 

Definition
aor-2 tungsten-containing aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ton  Thermococcus onnurineus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TON_1354
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TON_1354
Enzymes [BR:ton01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TON_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1223352..1225169
Genome map
AA seq 605 aa AA seqDB search
MFAYWGRILRVNLSTGKISEEKFDEKFAQKWLGTRGFGIYYLLKEIDPTVDPFSPENKII
YATGPLTGTTAPTGGRYMVITKSPLTGYIAMANSGGFFGAELKFAGWDAIIVEGKADHPV
YIYINDDQVEIRDASHLWGKLVSETEEKLREEVGDKRVRIASIGPAGENLVRFAAVMNDE
HRAAGRGGVGAVMGSKNLKAIVVRGHKRVEIADRAKFTSVVKEKIDKLRNDPVAGGGLPK
YGTAVLVNIINQNGLYPTRNFQDSQFEYAEEQSGEAMTAKYLIRNKPCYACPIGCGRVNK
LPTVGVTEGPEYESIWALGAHLGINDLASIIEANHMIDELGMDTISTGGTLATAMELFEK
GLIKPEDLGEEAPPFRWGNTEVLHYYIEKIARREGFGDKLAEGGYRLAEMYNGTEYFMGV
KKQELPAYDPRGAEGHGLGYATNNRGGGHIKQYMISPEILGYPYKMDPHDISDEKVKMVI
IFQDLTALIDAAGLCVFTTFGLGADDYRDMLNAALGWDLTTEEYLKIGERIWNAERLFNL
KAGLDPLKEDTLPKRLLEEPVKQGPNKGRVVRLKEMLPRYYALRGWTEDGRIPEEKLEEL
GLNEF
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatactggggaagaattttgagggttaacctaagcacaggcaaaatcagtgaa
gagaagttcgacgaaaagtttgcccagaagtggcttggaaccagaggatttggtatctac
tacctcctgaaggagatagacccaacggttgacccattcagccctgaaaacaaaataata
tacgccaccggcccgttgactggaaccactgccccaactggcggcagatacatggttata
accaagagcccactgactggctatatagccatggccaactccggtggcttcttcggagcc
gagctgaagttcgctggctgggacgctataatagtcgagggcaaggctgatcacccggtt
tacatatacataaacgacgaccaggttgaaatcagggatgcaagccacctctggggcaag
ctcgtgagcgagaccgaagagaaactcagggaagaagtcggcgacaagagggttcgcatc
gcctcaataggcccggcaggtgagaacctcgtccgcttcgctgcggtaatgaacgacgag
cacagggcagccggaagaggtggcgttggagccgtcatgggaagcaagaacctcaaggcg
atagtcgttcgcggccacaagagggttgagatcgccgacagggccaagttcaccagcgta
gtgaaggagaagatcgacaagctgaggaacgatcctgttgctggcggtggactgcccaag
tatggtaccgcagttcttgtcaatataatcaaccagaatggcctctacccgaccaggaac
ttccaggacagccagtttgagtacgccgaagagcagagcggtgaggccatgaccgccaaa
tacctcatcaggaataagccctgttacgcctgtccgatcggctgtggaagggtcaacaag
cttccaaccgtaggagtcaccgaaggtcccgaatacgagagcatctgggcgctcggagcg
cacctcggaataaacgacctggcaagcattatagaggctaaccacatgatagacgagctc
ggtatggacaccatttcaaccggtggaaccctcgccactgccatggagctcttcgagaag
ggcctaatcaagcctgaggatctcggcgaggaggctccgcccttcaggtggggcaacacc
gaggttctgcactactacatcgagaagatagccaggagagagggcttcggtgacaagctc
gccgagggtggctacaggcttgccgagatgtacaacggcaccgagtacttcatgggcgtc
aagaagcaggagcttccggcctacgacccgaggggtgcagagggccatggccttggttac
gctaccaacaaccgtggcggcggccacattaagcagtacatgataagtccggagatactt
ggctacccatacaagatggatccacacgacattagcgacgagaaggttaagatggtcata
atcttccaggatcttaccgcgttgatagacgccgcgggtctgtgtgtattcacaaccttc
ggacttggtgcggacgactaccgcgacatgcttaatgcagctctcggatgggacctcact
accgaggagtacctcaagatcggagagcgcatctggaacgcagagaggctcttcaacctc
aaggctggcctcgatccactcaaggaggacaccctgcccaagaggctcctcgaggagccc
gtcaagcagggtccgaataagggaagggtcgtcaggctcaaggagatgcttccgaggtac
tatgcactccgcggctggaccgaggatggaagaattcccgaggagaagctcgaggagctc
ggcctgaacgagttctga

DBGET integrated database retrieval system