KEGG   Thermococcus onnurineus: TON_1428Help
Entry
TON_1428          CDS       T00789                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ton  Thermococcus onnurineus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ton01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ton00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ton00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1306914..1308047
Genome map
AA seq 377 aa AA seqDB search
MKCPMCGKEYTEPIQRCECGEPVEFELFHGEPYIAKSVWERFYDFWPVEPNLELSLGEGD
TPLIRSRLGKELGVKLYLKNETANPTWSFKDRGTFLAMSYAVKVGYKAVGTVSTGNMAAS
VAAYAARAGLKAKILVSGSASDEKLKAVSIYGADVIRVMGDYGRLYFESLELGEELGIYF
MNSDNPFRVEGYKSIAFEIAEELTPDYVLIPTSSGGLFRGIAKGFLELFASGLIDKIPTL
IAVQAEGCSPICRAFSEGKGRIERFETPRTIAHAIENPYPPSGNVVLKLLRELGGKCVTV
SDEEILEAQKRLAEEGFFVQPSSATGIAALKKLNIPEEAKVVSILTGSGLKTISQIEGRS
VRECELEKLEGCLKSDS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcccaatgtgtgggaaggagtacaccgaacccattcagaggtgtgagtgcggc
gagcccgttgagttcgagctcttccatggcgagccgtacatagcaaagagtgtctgggag
cgcttttacgacttctggccggtcgagccaaacctcgagctgagcctcggtgagggggac
actccactgattaggtcaaggctcggcaaagagctcggcgtaaagctctacctcaagaac
gagacagccaatccaacgtggagcttcaaggacagggggacatttttggcgatgagctac
gcggttaaggtcggctacaaagccgttgggactgtatcgaccggcaacatggcggcgagc
gttgcagcctacgccgcaagagcgggcctgaaagccaagatactcgtctcagggagcgcg
agcgatgagaagctcaaggccgtatccatctacggagccgacgtgataagagtaatgggc
gactacggaaggctctacttcgagagtctggaactcggagaagagctcggcatctatttc
atgaactcggacaaccccttcagagtggaggggtataagagcatcgccttcgaaatcgcc
gaggagctaacgcccgactacgttctgattccgacctcatctggcggacttttcagagga
atagcaaagggctttctcgagctcttcgcgagcgggctgattgacaagatcccaacgctc
atagcggttcaagcagagggctgctcgcctatatgcagggctttctctgaagggaaaggg
aggatagagcgctttgagactccacggacgatagcccatgccatagagaatccttatccc
ccaagcgggaacgtcgtccttaagctcctccgtgagctgggcggaaagtgcgtgactgtt
agcgacgaagagattttagaggcacaaaagagactcgccgaagaaggcttcttcgtccag
ccctcaagcgcgacaggaatagccgccctcaaaaagctcaacatccccgaggaagcgaaa
gttgtctcaatcctcaccggttccggcctgaaaaccatttcccagatagaagggagaagc
gttagggagtgcgagcttgaaaagcttgagggatgtctcaaaagcgattcataa

DBGET integrated database retrieval system