KEGG   Thermococcus onnurineus: TON_1480Help
Entry
TON_1480          CDS       T00789                                 

Gene name
porD
Definition
pyuvate ferredoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
ton  Thermococcus onnurineus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TON_1480 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TON_1480 (porD)
   00020 Citrate cycle (TCA cycle)
    TON_1480 (porD)
   00620 Pyruvate metabolism
    TON_1480 (porD)
   00640 Propanoate metabolism
    TON_1480 (porD)
   00650 Butanoate metabolism
    TON_1480 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TON_1480 (porD)
   00680 Methane metabolism
    TON_1480 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TON_1480 (porD)
Enzymes [BR:ton01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TON_1480 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1354815..1355132
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERVQKEYSEKMTPGAIVYLPGSSVVNKTGSWRVFMPEFNRDKCVRCYLCY
IYCPEPAIYLDDENYPVFDYDYCKGCGICANECPTEAIVMVRETK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagtccgtttaaggccgacattgagagggttcagaaggagtatagcgaaaag
atgaccccgggagcgattgtctacctcccgggaagcagcgtcgtgaacaagaccggaagc
tggagagttttcatgccggagttcaacagggacaagtgcgttaggtgctatctctgctac
atctactgtccggagccagccatatatctcgacgatgagaactatccggtcttcgactac
gactactgtaagggctgtggaatttgtgcgaacgagtgcccgacagaggcaatagttatg
gttagggagaccaagtga

DBGET integrated database retrieval system