KEGG   Thermococcus onnurineus: TON_1481Help
Entry
TON_1481          CDS       T00789                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
ton  Thermococcus onnurineus
Pathway
ton00010  Glycolysis / Gluconeogenesis
ton00020  Citrate cycle (TCA cycle)
ton00620  Pyruvate metabolism
ton00633  Nitrotoluene degradation
ton00640  Propanoate metabolism
ton00650  Butanoate metabolism
ton00680  Methane metabolism
ton00720  Carbon fixation pathways in prokaryotes
ton01100  Metabolic pathways
ton01120  Microbial metabolism in diverse environments
ton01130  Biosynthesis of antibiotics
ton01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TON_1481
   00020 Citrate cycle (TCA cycle)
    TON_1481
   00620 Pyruvate metabolism
    TON_1481
   00640 Propanoate metabolism
    TON_1481
   00650 Butanoate metabolism
    TON_1481
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TON_1481
   00680 Methane metabolism
    TON_1481
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TON_1481
Enzymes [BR:ton01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TON_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C PRA-PH
Motif
Other DBs
NCBI-ProteinID: ACJ16971
UniProt: B6YY08
Position
1355144..1356328
Genome map
AA seq 394 aa AA seqDB search
MPIRKVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVADGELDAEFIKVESEH
SAISACVGASAAGVRTFTATASQGLALMHEILFIAAGMRLPIVIAVGNRALSAPINIWND
WQDTISERDTGWLQFYAENNQEALDLILIAFKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQELVDEFLGEYMPKHAYLDPAKPITQGALGFPAHYMEARYGVWEANENAKKVIDEVF
AEFEKKFGRKYQKIEEYRTEDADIIFVTMGSLAGTLKEYVDMLREKGVKVGAAKITVYRP
FPTEEVRELAKKTKVLALLEKNVTFSVGGALFQDFSRALVNESEKPKIVDFILGLGGRDV
TFKDLDEALAIAQKALTGEEFEEVNWIGLRKEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaggaaggttatgaaggctaacgaggctgctgcctgggcggccaagctggcc
aagccaaaggttatcgcagcgttcccaattacgccctccactctcgttcctgagaaaata
agtgagttcgtagccgatggagagcttgacgcagagttcatcaaggtcgagagcgagcac
tcagcaatttctgcttgtgtcggtgcttcggcggcaggtgttaggacctttaccgcgacc
gcttcccagggtctcgctttgatgcacgagatactcttcatcgcagcaggaatgaggctt
ccgatagtcattgccgttggaaaccgtgctctctcagctccgatcaacatctggaacgac
tggcaggacacaatcagcgagcgcgacaccggctggctccagttctacgccgaaaacaat
caggaagcccttgacctcatcctgatagccttcaaggtcgccgaagacgaaagggttctc
cttcctgcaatggtaggctttgacgcgttcatcctgacccacaccgtcgagccggttgag
atcccagaccaagagctcgtcgacgagttcctcggcgagtacatgccaaagcacgcctat
ctcgatccggccaagccgataacccagggtgcactcggattcccagcccactacatggag
gcccgctatggagtctgggaagctaacgagaacgctaagaaggtcatcgatgaggtcttc
gccgagttcgagaagaagttcggaaggaagtaccagaaaattgaagagtacaggaccgaa
gatgccgacataatcttcgtcaccatgggctccctcgccggaaccctcaaggagtatgtc
gacatgctccgcgagaagggcgttaaggtcggtgccgccaagatcaccgtttacaggcca
ttcccaaccgaagaagtcagggagctcgcaaagaagacaaaggttctcgcgcttctcgag
aagaacgtcactttcagcgtcggtggagccttattccaggacttcagcagggccttggtc
aacgagagtgagaagccaaagatagttgacttcatcctcggccttggaggcagggacgtc
accttcaaggaccttgatgaggctctagcaatagcgcagaaggccctcactggggaggag
tttgaggaagtcaactggataggacttagaaaggagatactgtga

DBGET integrated database retrieval system