KEGG   Thermococcus onnurineus: TON_1481Help
Entry
TON_1481          CDS       T00789                                 

Gene name
porA
Definition
pyruvate ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
ton  Thermococcus onnurineus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TON_1481 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TON_1481 (porA)
   00020 Citrate cycle (TCA cycle)
    TON_1481 (porA)
   00620 Pyruvate metabolism
    TON_1481 (porA)
   00640 Propanoate metabolism
    TON_1481 (porA)
   00650 Butanoate metabolism
    TON_1481 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TON_1481 (porA)
   00680 Methane metabolism
    TON_1481 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TON_1481 (porA)
Enzymes [BR:ton01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TON_1481 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355144..1356328
Genome map
AA seq 394 aa AA seqDB search
MPIRKVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVADGELDAEFIKVESEH
SAISACVGASAAGVRTFTATASQGLALMHEILFIAAGMRLPIVIAVGNRALSAPINIWND
WQDTISERDTGWLQFYAENNQEALDLILIAFKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQELVDEFLGEYMPKHAYLDPAKPITQGALGFPAHYMEARYGVWEANENAKKVIDEVF
AEFEKKFGRKYQKIEEYRTEDADIIFVTMGSLAGTLKEYVDMLREKGVKVGAAKITVYRP
FPTEEVRELAKKTKVLALLEKNVTFSVGGALFQDFSRALVNESEKPKIVDFILGLGGRDV
TFKDLDEALAIAQKALTGEEFEEVNWIGLRKEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaggaaggttatgaaggctaacgaggctgctgcctgggcggccaagctggcc
aagccaaaggttatcgcagcgttcccaattacgccctccactctcgttcctgagaaaata
agtgagttcgtagccgatggagagcttgacgcagagttcatcaaggtcgagagcgagcac
tcagcaatttctgcttgtgtcggtgcttcggcggcaggtgttaggacctttaccgcgacc
gcttcccagggtctcgctttgatgcacgagatactcttcatcgcagcaggaatgaggctt
ccgatagtcattgccgttggaaaccgtgctctctcagctccgatcaacatctggaacgac
tggcaggacacaatcagcgagcgcgacaccggctggctccagttctacgccgaaaacaat
caggaagcccttgacctcatcctgatagccttcaaggtcgccgaagacgaaagggttctc
cttcctgcaatggtaggctttgacgcgttcatcctgacccacaccgtcgagccggttgag
atcccagaccaagagctcgtcgacgagttcctcggcgagtacatgccaaagcacgcctat
ctcgatccggccaagccgataacccagggtgcactcggattcccagcccactacatggag
gcccgctatggagtctgggaagctaacgagaacgctaagaaggtcatcgatgaggtcttc
gccgagttcgagaagaagttcggaaggaagtaccagaaaattgaagagtacaggaccgaa
gatgccgacataatcttcgtcaccatgggctccctcgccggaaccctcaaggagtatgtc
gacatgctccgcgagaagggcgttaaggtcggtgccgccaagatcaccgtttacaggcca
ttcccaaccgaagaagtcagggagctcgcaaagaagacaaaggttctcgcgcttctcgag
aagaacgtcactttcagcgtcggtggagccttattccaggacttcagcagggccttggtc
aacgagagtgagaagccaaagatagttgacttcatcctcggccttggaggcagggacgtc
accttcaaggaccttgatgaggctctagcaatagcgcagaaggccctcactggggaggag
tttgaggaagtcaactggataggacttagaaaggagatactgtga

DBGET integrated database retrieval system