KEGG   Thermococcus onnurineus: TON_1497Help
Entry
TON_1497          CDS       T00789                                 

Definition
thermophile-specific fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ton  Thermococcus onnurineus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TON_1497
   01230 Biosynthesis of amino acids
    TON_1497
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TON_1497
   00030 Pentose phosphate pathway
    TON_1497
   00051 Fructose and mannose metabolism
    TON_1497
  Energy metabolism
   00680 Methane metabolism
    TON_1497
Enzymes [BR:ton01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TON_1497
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TON_1497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1368397..1369524
Genome map
AA seq 375 aa AA seqDB search
MAIGEKITISVIKADIGGWPGHSRVHPQLIEAAEEVLAKAKEEGTIIDFYVAYAGDDLQL
IMTHKKGVDSPDIHGLAWKAFEEATEIAKEFGLYGAGQDLLKDAFSGNIRGMGPGIAEME
ITLRKSEPIVTFHMDKTEPGAFNLPIFRMFADPFNTAGLVIDPNMHMGFRFEVWDIKEHK
RVILNTPEEIYDLLALIGAKSRYVIKRVYPKEGHKISKDEPVAVISTEKLYEIAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPIMPVPMHQANPTRFDGPPRV
VALGWQISPEGKLVGPVDLFDDPAFDYARQKALEITEYIRRHGPFEPHRLPLEDMEYTTL
PGVLKKLEERFEDIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccattggagagaaaataacgatcagtgttataaaggccgacataggtggatggcct
ggacattccagggttcatcctcagcttattgaagcggctgaagaagttctggcgaaggca
aaagaagaaggcactataatcgacttctacgtggcttacgctggtgatgatctccagctc
atcatgactcacaagaagggtgtcgacagcccggatatacacgggctcgcatggaaggct
ttcgaggaggccaccgagatcgccaaggagttcggcctttacggtgccggccaagacctt
ctcaaggacgctttcagcggcaacatcagaggaatgggtcctggcattgccgagatggag
attacgcttaggaagagcgagccgatagttacattccacatggacaaaaccgagcccggt
gcgtttaacctgccgatattcaggatgtttgcagatccgttcaacaccgcgggccttgtc
atagaccccaacatgcacatgggcttcaggtttgaagtctgggacattaaggagcacaag
cgtgttatccttaacactccagaggaaatttacgacctcttagctctcatcggcgccaag
agccgctacgtcatcaagagggtctacccgaaagagggccacaagataagcaaggacgaa
ccggtagctgttatcagcacggagaagctctacgagatagccggcgagtacgtcggcaag
gatgacccagttgccattgtcagggcccagagcggacttccggcccttggagaggtcctc
gagccctttgccttcccgcacctcgtcagcggctggatgcgcggaagccacaacggaccg
ataatgccagtcccaatgcatcaggccaatccgactaggtttgacggtccaccaagggtt
gttgcccttggctggcagataagcccagaaggaaagctcgtcggcccggttgacctcttc
gacgacccggcctttgactacgccaggcagaaggctctcgagataaccgagtacatacgc
aggcacgggcctttcgagccccacaggctgccgctcgaagatatggagtatactactctt
ccgggagtcctcaagaagcttgaggagcgctttgaggacattgagtga

DBGET integrated database retrieval system