KEGG   Thermococcus onnurineus: TON_1497Help
Entry
TON_1497          CDS       T00789                                 

Definition
thermophile-specific fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ton  Thermococcus onnurineus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TON_1497
   01230 Biosynthesis of amino acids
    TON_1497
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TON_1497
   00030 Pentose phosphate pathway
    TON_1497
   00051 Fructose and mannose metabolism
    TON_1497
  Energy metabolism
   00680 Methane metabolism
    TON_1497
Enzymes [BR:ton01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TON_1497
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TON_1497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1368397..1369524
Genome map
AA seq 375 aa AA seqDB search
MAIGEKITISVIKADIGGWPGHSRVHPQLIEAAEEVLAKAKEEGTIIDFYVAYAGDDLQL
IMTHKKGVDSPDIHGLAWKAFEEATEIAKEFGLYGAGQDLLKDAFSGNIRGMGPGIAEME
ITLRKSEPIVTFHMDKTEPGAFNLPIFRMFADPFNTAGLVIDPNMHMGFRFEVWDIKEHK
RVILNTPEEIYDLLALIGAKSRYVIKRVYPKEGHKISKDEPVAVISTEKLYEIAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPIMPVPMHQANPTRFDGPPRV
VALGWQISPEGKLVGPVDLFDDPAFDYARQKALEITEYIRRHGPFEPHRLPLEDMEYTTL
PGVLKKLEERFEDIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccattggagagaaaataacgatcagtgttataaaggccgacataggtggatggcct
ggacattccagggttcatcctcagcttattgaagcggctgaagaagttctggcgaaggca
aaagaagaaggcactataatcgacttctacgtggcttacgctggtgatgatctccagctc
atcatgactcacaagaagggtgtcgacagcccggatatacacgggctcgcatggaaggct
ttcgaggaggccaccgagatcgccaaggagttcggcctttacggtgccggccaagacctt
ctcaaggacgctttcagcggcaacatcagaggaatgggtcctggcattgccgagatggag
attacgcttaggaagagcgagccgatagttacattccacatggacaaaaccgagcccggt
gcgtttaacctgccgatattcaggatgtttgcagatccgttcaacaccgcgggccttgtc
atagaccccaacatgcacatgggcttcaggtttgaagtctgggacattaaggagcacaag
cgtgttatccttaacactccagaggaaatttacgacctcttagctctcatcggcgccaag
agccgctacgtcatcaagagggtctacccgaaagagggccacaagataagcaaggacgaa
ccggtagctgttatcagcacggagaagctctacgagatagccggcgagtacgtcggcaag
gatgacccagttgccattgtcagggcccagagcggacttccggcccttggagaggtcctc
gagccctttgccttcccgcacctcgtcagcggctggatgcgcggaagccacaacggaccg
ataatgccagtcccaatgcatcaggccaatccgactaggtttgacggtccaccaagggtt
gttgcccttggctggcagataagcccagaaggaaagctcgtcggcccggttgacctcttc
gacgacccggcctttgactacgccaggcagaaggctctcgagataaccgagtacatacgc
aggcacgggcctttcgagccccacaggctgccgctcgaagatatggagtatactactctt
ccgggagtcctcaagaagcttgaggagcgctttgaggacattgagtga

DBGET integrated database retrieval system