KEGG   Thermococcus onnurineus: TON_1497Help
Entry
TON_1497          CDS       T00789                                 

Definition
thermophile-specific fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ton  Thermococcus onnurineus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:ton01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ton01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ton00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ton00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ton00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:ton00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1368397..1369524
Genome map
AA seq 375 aa AA seqDB search
MAIGEKITISVIKADIGGWPGHSRVHPQLIEAAEEVLAKAKEEGTIIDFYVAYAGDDLQL
IMTHKKGVDSPDIHGLAWKAFEEATEIAKEFGLYGAGQDLLKDAFSGNIRGMGPGIAEME
ITLRKSEPIVTFHMDKTEPGAFNLPIFRMFADPFNTAGLVIDPNMHMGFRFEVWDIKEHK
RVILNTPEEIYDLLALIGAKSRYVIKRVYPKEGHKISKDEPVAVISTEKLYEIAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPIMPVPMHQANPTRFDGPPRV
VALGWQISPEGKLVGPVDLFDDPAFDYARQKALEITEYIRRHGPFEPHRLPLEDMEYTTL
PGVLKKLEERFEDIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccattggagagaaaataacgatcagtgttataaaggccgacataggtggatggcct
ggacattccagggttcatcctcagcttattgaagcggctgaagaagttctggcgaaggca
aaagaagaaggcactataatcgacttctacgtggcttacgctggtgatgatctccagctc
atcatgactcacaagaagggtgtcgacagcccggatatacacgggctcgcatggaaggct
ttcgaggaggccaccgagatcgccaaggagttcggcctttacggtgccggccaagacctt
ctcaaggacgctttcagcggcaacatcagaggaatgggtcctggcattgccgagatggag
attacgcttaggaagagcgagccgatagttacattccacatggacaaaaccgagcccggt
gcgtttaacctgccgatattcaggatgtttgcagatccgttcaacaccgcgggccttgtc
atagaccccaacatgcacatgggcttcaggtttgaagtctgggacattaaggagcacaag
cgtgttatccttaacactccagaggaaatttacgacctcttagctctcatcggcgccaag
agccgctacgtcatcaagagggtctacccgaaagagggccacaagataagcaaggacgaa
ccggtagctgttatcagcacggagaagctctacgagatagccggcgagtacgtcggcaag
gatgacccagttgccattgtcagggcccagagcggacttccggcccttggagaggtcctc
gagccctttgccttcccgcacctcgtcagcggctggatgcgcggaagccacaacggaccg
ataatgccagtcccaatgcatcaggccaatccgactaggtttgacggtccaccaagggtt
gttgcccttggctggcagataagcccagaaggaaagctcgtcggcccggttgacctcttc
gacgacccggcctttgactacgccaggcagaaggctctcgagataaccgagtacatacgc
aggcacgggcctttcgagccccacaggctgccgctcgaagatatggagtatactactctt
ccgggagtcctcaagaagcttgaggagcgctttgaggacattgagtga

DBGET integrated database retrieval system