KEGG   Thermococcus onnurineus: TON_1527Help
Entry
TON_1527          CDS       T00789                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ton  Thermococcus onnurineus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TON_1527
Enzymes [BR:ton01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TON_1527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1401861..1402418
Genome map
AA seq 185 aa AA seqDB search
MSRIVKAQLVKYSHLAHERGLTAAFGGNLSIRQGNLIFIKATGAIMDDMAREQVAVIDMN
GKQLSAIRPSSEYRLHLAIYRERPDVKAIAHLHPPYSIIAATMLEMELPIITPEAELYLR
RIPIVPFRPAGTKELAEAVAGVICQSDAVLMEKHGIVTVGKSLREAFYKAELVEESAKLW
YLLRK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtattgttaaagcccagcttgttaagtactctcatctcgcccacgagagggga
cttacggcggccttcggcgggaatctgagcatcagacagggaaatctgatcttcatcaaa
gcgaccggggccatcatggacgacatggcgagggaacaggtggcggtaatcgacatgaac
ggaaagcagctgtcagctattaggccctcctccgagtacaggctccacctggcgatctac
cgcgagagaccggacgtcaaggctatagcccacctccacccaccgtattcaataattgca
gcgaccatgctcgagatggaactcccgataataactccagaggcggagctgtacctaaga
aggataccgattgtaccctttaggcccgccggaacgaaggagctggcagaggctgtcgca
ggggttatatgtcagtcagacgccgtcctgatggaaaagcatggcatcgtcaccgtcggg
aagagcctgagggaagcattctacaaggccgaactggttgaggagagcgcaaagctgtgg
tatctgctcagaaaatga

DBGET integrated database retrieval system