KEGG   Thermococcus onnurineus: TON_1640Help
Entry
TON_1640          CDS       T00789                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ton  Thermococcus onnurineus
Pathway
ton00010  Glycolysis / Gluconeogenesis
ton00051  Fructose and mannose metabolism
ton00562  Inositol phosphate metabolism
ton01100  Metabolic pathways
ton01110  Biosynthesis of secondary metabolites
ton01120  Microbial metabolism in diverse environments
ton01130  Biosynthesis of antibiotics
ton01200  Carbon metabolism
ton01230  Biosynthesis of amino acids
Module
ton_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ton_M00002  Glycolysis, core module involving three-carbon compounds
ton_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TON_1640
   00051 Fructose and mannose metabolism
    TON_1640
   00562 Inositol phosphate metabolism
    TON_1640
Enzymes [BR:ton01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TON_1640
Exosome [BR:ton04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TON_1640
  Exosomal proteins of bladder cancer cells
   TON_1640
  Exosomal proteins of melanoma cells
   TON_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS NMO His_biosynth DHO_dh B12-binding NanE
Motif
Other DBs
NCBI-ProteinID: ACJ17130
UniProt: B6YUE5
Position
1498586..1499266
Genome map
AA seq 226 aa AA seqDB search
MTKLKEPIIAINFKTYIEATGERALEIAKAAEKVWKETGITIVVAPQLADLYRIAQEVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVKRVNPEVKVL
TGAGISTGEDVKKALELGSVGVLLASGVTKAKDPEKAIRDLVSLIV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagctgaaggagccgataatagcgataaacttcaagacgtacatcgaggccacg
ggcgagagagcccttgagatcgccaaggccgccgagaaggtctggaaggagactggaata
accatagtggtcgcgccgcagctggctgacctttacagaattgcccaggaggtcgagatt
ccggtctttgctcagcatatagacccgattaaaccgggaagccacaccggtcacgtcctc
ccggaggcagttaaagaagctggggccgtcggaactctcctcaatcattcggagaacaga
atgattttagcggacctcgaagctgccataaggcgcgccgaggaagttggattgatgaca
atggtctgctccaacaatccagcagtcagtgccgctgtcgccgctctggggccagattac
gtcgcagttgaaccgcctgagctgataggaacgggcattccagtcagcaaggccaaaccg
gaagtcataaccgacaccgtcgagctcgtcaagagggtaaacccagaggtcaaggttctt
accggcgcgggcatttccactggagaggacgtcaagaaggctttggagctcggaagcgtt
ggcgttctcctcgcgagcggcgttaccaaggcaaaagacccggagaaggcgataagggat
ctggtatcgctgattgtttga

DBGET integrated database retrieval system