KEGG   Thermococcus onnurineus: TON_1640Help
Entry
TON_1640          CDS       T00789                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ton  Thermococcus onnurineus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ton00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TON_1640
   01230 Biosynthesis of amino acids
    TON_1640
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TON_1640
   00051 Fructose and mannose metabolism
    TON_1640
   00562 Inositol phosphate metabolism
    TON_1640
Enzymes [BR:ton01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TON_1640
Exosome [BR:ton04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TON_1640
  Exosomal proteins of bladder cancer cells
   TON_1640
  Exosomal proteins of melanoma cells
   TON_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1498586..1499266
Genome map
AA seq 226 aa AA seqDB search
MTKLKEPIIAINFKTYIEATGERALEIAKAAEKVWKETGITIVVAPQLADLYRIAQEVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVKRVNPEVKVL
TGAGISTGEDVKKALELGSVGVLLASGVTKAKDPEKAIRDLVSLIV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagctgaaggagccgataatagcgataaacttcaagacgtacatcgaggccacg
ggcgagagagcccttgagatcgccaaggccgccgagaaggtctggaaggagactggaata
accatagtggtcgcgccgcagctggctgacctttacagaattgcccaggaggtcgagatt
ccggtctttgctcagcatatagacccgattaaaccgggaagccacaccggtcacgtcctc
ccggaggcagttaaagaagctggggccgtcggaactctcctcaatcattcggagaacaga
atgattttagcggacctcgaagctgccataaggcgcgccgaggaagttggattgatgaca
atggtctgctccaacaatccagcagtcagtgccgctgtcgccgctctggggccagattac
gtcgcagttgaaccgcctgagctgataggaacgggcattccagtcagcaaggccaaaccg
gaagtcataaccgacaccgtcgagctcgtcaagagggtaaacccagaggtcaaggttctt
accggcgcgggcatttccactggagaggacgtcaagaaggctttggagctcggaagcgtt
ggcgttctcctcgcgagcggcgttaccaaggcaaaagacccggagaaggcgataagggat
ctggtatcgctgattgtttga

DBGET integrated database retrieval system