KEGG   Thermococcus onnurineus: TON_1733Help
Entry
TON_1733          CDS       T00789                                 

Definition
histone acetyltransferase Elp3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ton  Thermococcus onnurineus
Brite
Enzymes [BR:ton01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TON_1733
Transfer RNA biogenesis [BR:ton03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TON_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1600173..1601951
Genome map
AA seq 592 aa AA seqDB search
MGGSDNFRRAVEELARAVLAGEIKTRDELNRYKIIVSRKYHLSKIPGNSDILKAIPEEER
DRFRDLLRRKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPSVGSPQSYTGKEPSALRA
VQSAYHPYIIMMRRLKQLTDIGHDVDKVEVIIQGGTFPAVDLDYQEWFIKCAFKAMNDFP
HFRDIENLEEKLVRLIVHGDKSVLDEDPKFKEAWEKTHRKPYYYLEDEQRKNEKANVRMV
GLTIETRPDWAFERQIDRMLKLGTTRVELGVQTIFNFIHERTKRGHGVEEIVKATQLLRD
AGLKINYHIMPGLPGSNFERDLYTFRAIFEDARFRPDMLKVYPTLITADAPLYRWWKEGK
YRPYRTEEAVELLVEAYKLFPKWVRVMRIQRDIPAKLIVDGVKHSNLGQLVFNELIKRGI
RPREIRFREVGHMMQKFGVEPEMEHIELLREDYDAAGGKEIFLSFEDTKNDILIGFLRLR
IPSEKAHRKEINCCPSAIVRELHVYGPLVPIGGKPKYEWQHRGYGRELLAEAERIAREEF
DVKKMLVISGVGVREYYRKFGYRKNGPYVAKRLDKSYADFGKSKSFDAHLNT
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggagtgacaacttcaggcgagcggttgaggagcttgcgagggcagttttggcg
ggcgagattaaaacgcgggacgagcttaaccgctacaagataatcgtctctaggaagtat
cacctctccaaaattcccggcaactcggacatcttgaaggctatacctgaggaagagcgc
gaccgctttagggatctgctccggaggaagccaaccagaacgataagcggcgttgcagtc
gttgccatgatgaccaagcctttcccctgtccccacggacgctgcatctactgcccgggc
ggtccgagcgttggctctcctcagagctatactggaaaagaaccttccgctctgagggcc
gtccagagcgcttaccacccctatatcatcatgatgcgcaggctaaagcagctcactgac
ataggccacgacgtggacaaggtcgaggtcataatccagggtggaacttttccagcggtt
gatctggattaccaggaatggttcatcaagtgcgccttcaaggccatgaacgacttcccg
cacttcagggacatagaaaacctcgaggagaagcttgtccgcctgatagtccacggagat
aagtccgtccttgacgaggatccgaagttcaaggaggcctgggagaagacgcacagaaag
ccctactattatctcgaagatgagcagaggaagaacgagaaggctaatgtgaggatggtc
ggattaacgatagagacccgcccggactgggccttcgaaaggcagattgacaggatgctc
aagctgggaacgacgcgcgttgagctcggtgttcagacgattttcaacttcatccacgag
aggaccaagcgcggccacggtgttgaggagatagttaaggctacccagctcctccgcgac
gctgggttgaagataaactaccacataatgcctggtctgcccgggagcaacttcgagagg
gatttgtacaccttcagagcaatattcgaggatgctcgcttcaggccggacatgctgaag
gtatacccgacccttattaccgccgacgctcctctctaccgctggtggaaggaaggtaaa
taccggccataccgcacggaggaagccgttgagcttctcgtcgaggcctacaagctcttc
cccaagtgggttcgcgtcatgagaatccagcgcgacatcccggcaaagctcatcgtcgac
ggcgtcaagcactccaaccttggacagcttgtcttcaacgagctgattaagagaggaatt
cgtccgagggagattaggtttagagaggttggccatatgatgcagaagttcggtgtggag
cccgagatggagcacatcgagcttcttagggaggactacgatgcagctggcggtaaagag
atattcctcagttttgaggatacgaagaatgacatcctcataggcttcctccgcctgagg
attccgagtgaaaaagcccatcggaaggagataaactgctgtccttcggccattgtcagg
gagctccatgtctacggtccgctcgtgccgattggcgggaaaccgaagtacgagtggcag
caccgcggctatggacgggagcttcttgctgaggcggagaggattgcccgcgaggagttt
gacgtcaagaaaatgcttgtcataagcggcgtaggtgtgagggagtattaccgtaagttt
ggctatcggaagaacggtccgtacgttgccaaaaggcttgacaaaagctacgcagacttt
ggcaagagcaaaagcttcgatgcacacttaaacacttaa

DBGET integrated database retrieval system