KEGG   Thermococcus onnurineus: TON_1968Help
Entry
TON_1968          CDS       T00789                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ton  Thermococcus onnurineus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ton00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17841..18380
Genome map
AA seq 179 aa AA seqDB search
MPEDALIVVDMQRDFMPGGALPVPDGDKIIPRVNEYIRKFKERGALIVATRDWHPEDHIS
FMDQGGPWPKHCVQNTPGAEFVVELPEDAVIISKAADPDKEAYSGFEGTNLAEILKEKGV
KRVYVCGVATEYCVKATALDAVRHGFETYLLRDAVRGINPEDEENALRELEQAGVKVLS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggatgccttgatagttgtggacatgcagagggatttcatgcctggaggagcc
ctgcccgttccggatggtgacaaaatcatcccgagggtgaacgagtacatcagaaagttc
aaggaacgcggggctctgatagttgccacgagggactggcaccctgaggatcacatcagc
tttatggatcagggaggtccctggccgaagcactgcgttcagaacacgcctggtgccgag
ttcgttgttgaacttcctgaagatgcagtgataatctcgaaggcggccgatccggataag
gaggcctactccggcttcgaagggaccaacctggctgaaatcctgaaggagaagggtgta
aagcgcgtttacgtctgcggtgtggcaacggagtactgtgttaaagccacggccctcgac
gcggtcaggcacggctttgagacctatctcctacgcgatgccgttaggggcatcaatcct
gaggatgaggagaatgctttgagggagttggagcaggctggtgtgaaggtcctttcctag

DBGET integrated database retrieval system