KEGG   Thermodesulfobacterium geofontis: TOPB45_0046Help
Entry
TOPB45_0046       CDS       T01547                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00900  Terpenoid backbone biosynthesis
top01100  Metabolic pathways
top01110  Biosynthesis of secondary metabolites
top01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TOPB45_0046
Enzymes [BR:top01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TOPB45_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh NAD_binding_3 Epimerase NmrA GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AEH22163
UniProt: F8C211
Position
43646..44806
Genome map
AA seq 386 aa AA seqDB search
MKNLVIFGATGSIGKATIKYIKNQPHRFRIIGLTAKSKIEELQKLSETFKVPYIVVEREE
DAKFLNSSLSYKAKVLWGDEGLKELASLDSVDTVVIGISGIKALIPTYYALKSGKRVAIA
NKECIISVGNLLKEVAQENKAELIPVDSEHSAFFQLLQKEKKTYVEKLILTASGGPFYKT
PLKDFCKITPEKAISHPVWKMGKKISVDSATLMNKGFEVLEAMVLFDFPLDKIEVVIHPQ
GLVHGIVKLIDGCYLMHVSPADMKIAIAYALNYPERTEVPVENLDLTKAKLIFKKPSFKK
FPCLKLAYEVGKLGGAYPLILEAADEVVVSAFLSYKISFDKIPYFLEKTLNEFKIPSINF
KNIYEVLELHKRVCEFTENLIEGVNR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttagtaatctttggagctacaggatccataggaaaagcaactataaaatat
atcaaaaaccaacctcatagatttagaattataggacttacagcgaaatcaaaaattgaa
gaacttcaaaaactttcagaaacttttaaagtaccttatatagtcgtagaaagggaagaa
gatgcaaaatttttgaattcctctttaagttacaaagcaaaagtattatggggagacgaa
ggattaaaagaacttgcttctttagattctgtagatacagtagttataggaatctcagga
ataaaagctcttattcctacctattatgctttaaaatcaggaaaaagggtagctatagcg
aataaggaatgtattatctctgtaggaaatcttttaaaggaggttgctcaagaaaataaa
gctgaactcattcctgtagacagtgaacattctgctttttttcaattattacaaaaagag
aaaaaaacatatgtagaaaaacttattcttactgcttcaggaggacctttttataaaact
ccattaaaggatttttgtaaaataacacccgaaaaagctatatctcatcctgtatggaaa
atgggtaaaaaaatttctgttgattcagcaactttaatgaataaaggttttgaagtactt
gaagctatggtattatttgattttcctttagataaaattgaagtagttattcatcctcaa
ggattagtccatggtatagttaaacttatagatggttgttatttaatgcatgtaagtcct
gctgatatgaaaattgctatagcttatgctttaaattatccagaaagaactgaagtacca
gtagaaaatcttgatcttacgaaagcaaaacttatttttaaaaagccaagttttaaaaaa
ttcccttgcctaaaactcgcttatgaagtaggaaaacttggaggagcttatcctttaata
ttagaagctgcagatgaagtagtagtttctgcttttctttcttacaaaattagttttgat
aaaattccgtattttcttgaaaaaaccttaaatgaatttaaaataccctctattaatttt
aaaaatatttatgaggttttagagcttcataaaagggtttgtgaatttactgaaaatctt
attgagggtgtaaatagatga

DBGET integrated database retrieval system