KEGG   Thermodesulfobacterium geofontis: TOPB45_0074Help
Entry
TOPB45_0074       CDS       T01547                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00900  Terpenoid backbone biosynthesis
top01100  Metabolic pathways
top01110  Biosynthesis of secondary metabolites
top01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TOPB45_0074
Enzymes [BR:top01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TOPB45_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEH22190
UniProt: F8C238
Position
71051..71884
Genome map
AA seq 277 aa AA seqDB search
MKSYFLLSPAKINLTLQVLKKRENNYHEIYTIFQKIDLFDEIEIKRGVRSFSLEFFCDYP
IPLEENLVYKAYKLFRETFGIKEELAIKVKKTIPIGAGLGGGSSNAASILKGLAYLYGIN
LEKLYNLAKILGADVPFFLSPYLSAIGLGIGNEIMPFPNFSSWYIIIYPNFQISTKWAYE
NLGLTKSKNPIYYTSEIPPWHQPQGLINDFENLIFEKYERLKEYKEILKKIGACAVSISG
TGSSIFGVFYEEPPFFAYKTLKSLLKDCKLFLVKNLE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttatttccttctttctcctgcaaaaatcaatcttactcttcaagttttaaaa
aaaagagaaaataattatcatgaaatatatactatttttcaaaaaattgatctttttgat
gaaattgaaataaaaagaggagtaagaagtttttctttagaatttttttgtgactatcct
attcctttagaggaaaatttagtttataaagcctataagttatttagggaaacctttggt
ataaaagaggaattagctataaaagttaaaaaaactatccctattggtgcagggttagga
ggaggaagcagtaatgcggcttctattttaaaaggattagcctatctttatggtataaat
ttagaaaaactctataatttagctaaaatcttaggagctgatgtacccttctttttaagc
ccatacctttctgctataggattagggataggaaatgaaataatgccttttcccaatttt
tcatcttggtacattataatatatcctaattttcaaattagcactaaatgggcttatgaa
aatttaggattgacaaagtcaaaaaatccgatttattataccagcgaaatccccccttgg
catcaacctcaaggacttattaatgattttgaaaatttaatttttgaaaaatatgaaaga
ttaaaggagtataaagagattttaaaaaaaattggagcttgtgcagtgagtataagtgga
acaggatcttcaatttttggtgtattttatgaagagccacccttttttgcttataaaact
ttgaaatctcttttgaaggattgcaaattattcttagtgaaaaatttagaataa

DBGET integrated database retrieval system