KEGG   Thermodesulfobacterium geofontis: TOPB45_0104Help
Entry
TOPB45_0104       CDS       T01547                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TOPB45_0104
   01230 Biosynthesis of amino acids
    TOPB45_0104
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOPB45_0104
   00051 Fructose and mannose metabolism
    TOPB45_0104
   00562 Inositol phosphate metabolism
    TOPB45_0104
Enzymes [BR:top01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TOPB45_0104
Exosome [BR:top04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TOPB45_0104
  Exosomal proteins of bladder cancer cells
   TOPB45_0104
  Exosomal proteins of melanoma cells
   TOPB45_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(98266..99036)
Genome map
AA seq 256 aa AA seqDB search
MRKYLFAGNWKMNKTLKETEEYFNKFLKRLSEIDFSDREIMIAPPFTVLAYSKNFIKNTP
LKLGAQNSCWEEKGAFTGEISPVMLKELGVEYVILGHSERRHIFGESNELIAKRVEGVYK
FELIPILCVGETLEERNKGKTLEVVEKQLLEGLSNIKDIKGDKIVIAYEPVWAIGTGINA
TPEEAEEVHSFIRERLKNLYSKEISTQIRILYGGSVTPDNIQDLMKKPNIDGVLVGGASL
DPEKFFKICNIKVEKE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatacctttttgccggaaattggaaaatgaataaaactttaaaggagacagaa
gagtattttaataaatttctaaaaagactttctgaaattgatttttccgatagagaaata
atgatagctcctccttttactgttttagcttattctaaaaattttataaaaaatacccct
ttaaaattaggagcacaaaattcctgctgggaggaaaagggagcttttacaggagaaata
tctcctgttatgcttaaagagttaggtgttgaatatgttattttaggacattctgaaaga
agacatatttttggagaatctaatgagttgatagctaaaagagtggaaggggtatataaa
tttgaacttattcctattttgtgtgtaggagaaaccttagaagagagaaataaaggtaaa
accttagaagtagtagaaaagcaacttttagaaggactttcaaatattaaagatataaaa
ggcgataaaattgttattgcttatgaacctgtatgggctattggaaccggaattaatgct
actcctgaagaagcagaagaggttcattcttttattagagaaaggttaaagaatctttat
tcaaaagaaataagtacccaaattagaattctttatggagggagtgttaccccagataat
attcaggatctaatgaaaaaacctaatatagatggtgttcttgtaggtggtgcctccctt
gacccagaaaaattttttaaaatctgtaatataaaagtggagaaggaataa

DBGET integrated database retrieval system