KEGG   Thermodesulfobacterium geofontis: TOPB45_0104Help
Entry
TOPB45_0104       CDS       T01547                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00010  Glycolysis / Gluconeogenesis
top00051  Fructose and mannose metabolism
top00562  Inositol phosphate metabolism
top01100  Metabolic pathways
top01110  Biosynthesis of secondary metabolites
top01120  Microbial metabolism in diverse environments
top01130  Biosynthesis of antibiotics
top01200  Carbon metabolism
top01230  Biosynthesis of amino acids
Module
top_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOPB45_0104
   00051 Fructose and mannose metabolism
    TOPB45_0104
   00562 Inositol phosphate metabolism
    TOPB45_0104
Enzymes [BR:top01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TOPB45_0104
Exosome [BR:top04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TOPB45_0104
  Exosomal proteins of bladder cancer cells
   TOPB45_0104
  Exosomal proteins of melanoma cells
   TOPB45_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEH22220
UniProt: F8C262
Position
complement(98266..99036)
Genome map
AA seq 256 aa AA seqDB search
MRKYLFAGNWKMNKTLKETEEYFNKFLKRLSEIDFSDREIMIAPPFTVLAYSKNFIKNTP
LKLGAQNSCWEEKGAFTGEISPVMLKELGVEYVILGHSERRHIFGESNELIAKRVEGVYK
FELIPILCVGETLEERNKGKTLEVVEKQLLEGLSNIKDIKGDKIVIAYEPVWAIGTGINA
TPEEAEEVHSFIRERLKNLYSKEISTQIRILYGGSVTPDNIQDLMKKPNIDGVLVGGASL
DPEKFFKICNIKVEKE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatacctttttgccggaaattggaaaatgaataaaactttaaaggagacagaa
gagtattttaataaatttctaaaaagactttctgaaattgatttttccgatagagaaata
atgatagctcctccttttactgttttagcttattctaaaaattttataaaaaatacccct
ttaaaattaggagcacaaaattcctgctgggaggaaaagggagcttttacaggagaaata
tctcctgttatgcttaaagagttaggtgttgaatatgttattttaggacattctgaaaga
agacatatttttggagaatctaatgagttgatagctaaaagagtggaaggggtatataaa
tttgaacttattcctattttgtgtgtaggagaaaccttagaagagagaaataaaggtaaa
accttagaagtagtagaaaagcaacttttagaaggactttcaaatattaaagatataaaa
ggcgataaaattgttattgcttatgaacctgtatgggctattggaaccggaattaatgct
actcctgaagaagcagaagaggttcattcttttattagagaaaggttaaagaatctttat
tcaaaagaaataagtacccaaattagaattctttatggagggagtgttaccccagataat
attcaggatctaatgaaaaaacctaatatagatggtgttcttgtaggtggtgcctccctt
gacccagaaaaattttttaaaatctgtaatataaaagtggagaaggaataa

DBGET integrated database retrieval system