KEGG   Thermodesulfobacterium geofontis: TOPB45_0214Help
Entry
TOPB45_0214       CDS       T01547                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOPB45_0214
   00030 Pentose phosphate pathway
    TOPB45_0214
   00051 Fructose and mannose metabolism
    TOPB45_0214
   00052 Galactose metabolism
    TOPB45_0214
   00500 Starch and sucrose metabolism
    TOPB45_0214
   00520 Amino sugar and nucleotide sugar metabolism
    TOPB45_0214
  Nucleotide metabolism
   00230 Purine metabolism
    TOPB45_0214
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TOPB45_0214
Enzymes [BR:top01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TOPB45_0214
    5.4.2.8  phosphomannomutase
     TOPB45_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
202737..204101
Genome map
AA seq 454 aa AA seqDB search
MKISPYIFREYDIRGKVGEDFTEEVVKEIGKAYGTIIRRKGGRKICCGRDGRLSSSSLQE
ALIEGILSTGIEVINIGICPTPVMYFSLFAFEDSDGGIQVTGSHNPPEFNGLKICVGKDT
IFGPQIQEIRKIIEKKDYEKGNGKIEEREILNKYIDYVCNNIELKRPLKVVLDPGNGVCS
LTAPEIFKRLGCEVECLFCEIDGTFPNHFPDPVVPENLKWLKDKVLKGGYEVGFGYDGDG
DRLGVIDEKGNIIWGDQLLIILAKDLLKKYPGAKIIGEVKCSRTLYETIAKLGGIPIMWK
TGHSLIKNKMKEEKALLAGEMSGHIFFADKWFGFDDGVYASLRLIEILSQNNIPLSEYLK
DIPKMYSTPEIRKECPDEVKFKVVERLIKKFKNEGLNVIDVDGARIEFKEGWALVRASNT
QPVLVLRFEAETEEFLKRLQDIVYKSLEEILKEV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcccttatatttttagggaatatgatattagaggaaaagttggagaagat
tttactgaggaagtagttaaagaaattggaaaagcctacggaacaattatcagaagaaag
ggaggaagaaaaatttgttgcggaagagatggaagactctcctcttcctctttacaagaa
gcacttattgaggggattttatcaactggaattgaagtaataaatataggaatttgtcct
acacctgtaatgtatttctctctttttgcttttgaagattctgatgggggaatccaagtt
acaggttcacataatcccccagaatttaatggtttaaaaatctgtgtaggaaaggatacc
atctttggaccccaaattcaagaaataagaaaaattattgaaaaaaaggattatgaaaaa
ggaaatggaaaaattgaagaaagagagattttaaacaaatatatagattatgtttgcaat
aatatagaattaaaaagaccattaaaagtggttttagacccaggaaatggagtttgtagt
ttaacagctcctgaaatttttaaaaggctcggttgtgaggtagaatgccttttttgtgaa
atagacggaaccttccctaatcactttcctgatcctgttgttcctgaaaatctaaaatgg
cttaaagataaggttttaaaaggtggatatgaagtaggttttggatacgatggagatgga
gataggttaggagttattgatgaaaaaggaaatattatttggggagaccagcttttaatc
attcttgctaaggatttattaaaaaaatatccaggagcaaaaataataggagaagttaaa
tgctccagaaccttgtacgaaacaatagctaaacttggaggaataccaataatgtggaaa
acaggtcattctcttattaaaaataaaatgaaagaagaaaaggcacttcttgcaggagaa
atgagtggacacatcttttttgcagataaatggttcggatttgatgacggagtatatgct
tctttaagacttattgaaatcttatctcaaaataatatccctctttctgaatatttaaaa
gatattcccaagatgtattctacacctgaaataagaaaggaatgcccagatgaagtaaaa
tttaaagtagttgaaagattaataaaaaaatttaaaaatgaaggcttaaatgtgattgat
gttgatggagcaagaattgaatttaaggaaggatgggctttagtaagagcctcaaataca
caaccagttcttgttttaagatttgaagcagaaacagaagaatttttaaaaagattgcag
gatatagtttataaatccttagaggaaattcttaaagaggtatag

DBGET integrated database retrieval system