KEGG   Thermodesulfobacterium geofontis: TOPB45_0214Help
Entry
TOPB45_0214       CDS       T01547                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00010  Glycolysis / Gluconeogenesis
top00030  Pentose phosphate pathway
top00051  Fructose and mannose metabolism
top00052  Galactose metabolism
top00230  Purine metabolism
top00500  Starch and sucrose metabolism
top00520  Amino sugar and nucleotide sugar metabolism
top00521  Streptomycin biosynthesis
top01100  Metabolic pathways
top01110  Biosynthesis of secondary metabolites
top01120  Microbial metabolism in diverse environments
top01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOPB45_0214
   00030 Pentose phosphate pathway
    TOPB45_0214
   00051 Fructose and mannose metabolism
    TOPB45_0214
   00052 Galactose metabolism
    TOPB45_0214
   00500 Starch and sucrose metabolism
    TOPB45_0214
   00520 Amino sugar and nucleotide sugar metabolism
    TOPB45_0214
  Nucleotide metabolism
   00230 Purine metabolism
    TOPB45_0214
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TOPB45_0214
Enzymes [BR:top01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TOPB45_0214
    5.4.2.8  phosphomannomutase
     TOPB45_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AEH22329
UniProt: F8C2V2
Position
202737..204101
Genome map
AA seq 454 aa AA seqDB search
MKISPYIFREYDIRGKVGEDFTEEVVKEIGKAYGTIIRRKGGRKICCGRDGRLSSSSLQE
ALIEGILSTGIEVINIGICPTPVMYFSLFAFEDSDGGIQVTGSHNPPEFNGLKICVGKDT
IFGPQIQEIRKIIEKKDYEKGNGKIEEREILNKYIDYVCNNIELKRPLKVVLDPGNGVCS
LTAPEIFKRLGCEVECLFCEIDGTFPNHFPDPVVPENLKWLKDKVLKGGYEVGFGYDGDG
DRLGVIDEKGNIIWGDQLLIILAKDLLKKYPGAKIIGEVKCSRTLYETIAKLGGIPIMWK
TGHSLIKNKMKEEKALLAGEMSGHIFFADKWFGFDDGVYASLRLIEILSQNNIPLSEYLK
DIPKMYSTPEIRKECPDEVKFKVVERLIKKFKNEGLNVIDVDGARIEFKEGWALVRASNT
QPVLVLRFEAETEEFLKRLQDIVYKSLEEILKEV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcccttatatttttagggaatatgatattagaggaaaagttggagaagat
tttactgaggaagtagttaaagaaattggaaaagcctacggaacaattatcagaagaaag
ggaggaagaaaaatttgttgcggaagagatggaagactctcctcttcctctttacaagaa
gcacttattgaggggattttatcaactggaattgaagtaataaatataggaatttgtcct
acacctgtaatgtatttctctctttttgcttttgaagattctgatgggggaatccaagtt
acaggttcacataatcccccagaatttaatggtttaaaaatctgtgtaggaaaggatacc
atctttggaccccaaattcaagaaataagaaaaattattgaaaaaaaggattatgaaaaa
ggaaatggaaaaattgaagaaagagagattttaaacaaatatatagattatgtttgcaat
aatatagaattaaaaagaccattaaaagtggttttagacccaggaaatggagtttgtagt
ttaacagctcctgaaatttttaaaaggctcggttgtgaggtagaatgccttttttgtgaa
atagacggaaccttccctaatcactttcctgatcctgttgttcctgaaaatctaaaatgg
cttaaagataaggttttaaaaggtggatatgaagtaggttttggatacgatggagatgga
gataggttaggagttattgatgaaaaaggaaatattatttggggagaccagcttttaatc
attcttgctaaggatttattaaaaaaatatccaggagcaaaaataataggagaagttaaa
tgctccagaaccttgtacgaaacaatagctaaacttggaggaataccaataatgtggaaa
acaggtcattctcttattaaaaataaaatgaaagaagaaaaggcacttcttgcaggagaa
atgagtggacacatcttttttgcagataaatggttcggatttgatgacggagtatatgct
tctttaagacttattgaaatcttatctcaaaataatatccctctttctgaatatttaaaa
gatattcccaagatgtattctacacctgaaataagaaaggaatgcccagatgaagtaaaa
tttaaagtagttgaaagattaataaaaaaatttaaaaatgaaggcttaaatgtgattgat
gttgatggagcaagaattgaatttaaggaaggatgggctttagtaagagcctcaaataca
caaccagttcttgttttaagatttgaagcagaaacagaagaatttttaaaaagattgcag
gatatagtttataaatccttagaggaaattcttaaagaggtatag

DBGET integrated database retrieval system