KEGG   Thermodesulfobacterium geofontis: TOPB45_0235Help
Entry
TOPB45_0235       CDS       T01547                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00520  Amino sugar and nucleotide sugar metabolism
top01100  Metabolic pathways
top01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TOPB45_0235
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    TOPB45_0235
Enzymes [BR:top01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TOPB45_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AEH22349
UniProt: F8C2X0
Position
complement(223469..224401)
Genome map
AA seq 310 aa AA seqDB search
MFKKIGKLFLIKPENIKENITLYKELSFVNFLFFKEHFEEDFDYFLSNLREKLELKFLAV
DQEGGRVCRIEGDHDSPLEIAKKYKKEGEKVVENWAKKIANSVKKYGLNLNLSPCVDLAD
EDAEEFLKERTFGKDPVLVKKLAYIFIKEHKKEKIFTCLKHFPGLKDVKIDPHKDLPFKE
RIDRESLSPYEKLLEKEKINFIMTAHLIIKEIDTKPATFSSNIIKILRNNLNYRGAILTD
DLNMGALKNWELQERIILSLASGHNLLIYCGNFDNLVYALEDIKSELEKSLVLKEKIKES
FFIFENIRWN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaattgggaaactctttttaattaagccagaaaacattaaggaaaatatt
accctttacaaagagcttagttttgtaaattttctcttttttaaagaacattttgaagaa
gattttgattattttctctctaatttaagagaaaaacttgagctaaaatttttagctgtg
gatcaggaagggggaagagtttgtagaattgagggagatcatgattcaccccttgaaata
gctaaaaagtataaaaaagaaggagagaaggtagttgaaaattgggctaaaaaaatagct
aattctgtaaaaaaatacggacttaaccttaatctctctccttgtgttgatcttgctgat
gaagatgctgaagaatttttaaaagagagaacctttggtaaagatccagttttagtaaaa
aagctcgcctatatttttataaaagaacataaaaaagagaaaatatttacttgtttaaaa
cattttccaggcttaaaagatgttaaaatagatcctcataaagatcttccttttaaagaa
agaatagatagagaaagtctttctccctatgaaaagcttcttgaaaaagaaaaaataaat
tttattatgactgcccatctaattataaaggaaattgatactaagccagcaaccttttct
tccaatataataaaaatcttaagaaataatttaaattatagaggtgcaattcttactgat
gacttaaatatgggggcattaaaaaattgggagcttcaagaaaggattattttaagttta
gcaagtggacataatcttttaatttattgtggcaattttgataatttagtctatgcttta
gaagatataaaaagtgaattggaaaagagtttagtattaaaagaaaaaattaaagaaagt
ttttttatttttgaaaatattagatggaactaa

DBGET integrated database retrieval system