KEGG   Thermodesulfobacterium geofontis: TOPB45_0261Help
Entry
TOPB45_0261       CDS       T01547                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TOPB45_0261
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TOPB45_0261
Enzymes [BR:top01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TOPB45_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
257359..258321
Genome map
AA seq 320 aa AA seqDB search
MDLKIKHLLDIASLSKEEIEDFLNLAENLKEILYRPIPKVPTLRGKLIINLFYEPSTRTR
FSFEKAAKTLSADSLTFTGKGTSIEKGETLLDTIKNLEAIGADLFIIRHPVAGAPHFVAK
YSKVPIINAGDGTHEHPTQALLDLLTVKEKLGTLSDLKVAIIGDIKHSRVAHSDILAFQK
MGSTVWVSGPVHLLPDIKEENYFKLSERSFKICYKIEDAIKDADIIIALRIQRERHGEAL
IPSFLEYHEFFGLKPEHLELMKEKTILMHPGPINWGVELAYEMEKYPFQVILDQVENGVA
IRMAILLRFLTGERGYEDFN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaaattaagcatcttcttgatattgcttctctttctaaggaggaaatagaa
gattttttaaatttagcagaaaatttaaaagaaattctctatagaccaattcccaaagtt
cctactttaagaggaaaattgataattaatttattttatgaaccatcaactcggactcgc
ttttcttttgaaaaggctgctaaaaccttatctgcagatagtttaacttttacaggtaaa
ggtacaagtatagaaaagggagaaactcttttagatactattaaaaatttagaagctata
ggagcagatctttttattattagacatcctgttgctggggcacctcattttgtagctaaa
tatagtaaagttcccattattaatgctggggatggaactcatgagcatcccactcaagca
cttttagaccttttaactgttaaagaaaaacttggaactctttcagatttaaaggttgca
attataggagatataaagcatagtagagttgctcattcagatatattagcctttcagaaa
atgggatccactgtttgggtttctggcccagttcatcttttaccagatattaaagaggaa
aattattttaagctttctgagaggagttttaaaatttgttataaaatagaagacgctatt
aaagatgcagatataataatagctctaagaatacagagagaaagacatggagaagctctt
atcccaagttttttagaatatcatgagttctttggtttaaaaccagaacatttggaatta
atgaaagaaaaaacaatccttatgcatcctggacctataaattggggagtagaacttgct
tatgaaatggaaaaatatccctttcaagtaattttagaccaagtagaaaatggagtagct
ataagaatggcaattctgttaaggtttttaacaggtgaaagaggttatgaagattttaat
taa

DBGET integrated database retrieval system