KEGG   Thermodesulfobacterium geofontis: TOPB45_0295Help
Entry
TOPB45_0295       CDS       T01547                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TOPB45_0295
Enzymes [BR:top01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TOPB45_0295
Exosome [BR:top04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TOPB45_0295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
294402..295379
Genome map
AA seq 325 aa AA seqDB search
MLFPEYRPRRLRRTENIRSLVRETHLTIDDLIYPLFICEGKNIKQEIRSMPEVYRFSIDK
ALEEIKEATQLGIKAVLLFGIPNKKDEVGTSAYIENGIIQKAVRAIKDKFPELIVITDVC
LCEYTSHGHCGIIKNGEVDNDLTLEVLAKIAVSHAKAGADIVAPSDMMDGRVGRIREALD
EAGFSHVAIMSYAVKYCSAFYGPFREAAESAPKFGDRRSYQMDPANSREALREASLDIEE
GADIIMVKPAMPYLDIIKMLRNEFNYPLAAYQVSGEYAMIKAAAKLGWLDEEKILWESLI
SIKRAGADLIITYFAKKIAKKLNEK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcttttccctgaatatcgccccagaagacttagaagaacagagaatataagatcttta
gttagagaaactcatcttactatagatgatttaatttatcctctttttatttgtgaagga
aaaaatattaagcaagaaataagatcaatgccagaggtttatagattttctattgataaa
gctttagaagaaataaaagaagctactcaattaggaataaaagcagttttactttttgga
atacctaataaaaaggatgaagtaggaacttctgcttatatagaaaacggaataattcaa
aaggcagtaagagcaattaaagataaattcccagaactaattgtaattactgatgtttgt
ctttgtgaatatacttctcatggacactgtggaattataaaaaatggagaagtagataat
gatttaaccttggaagttcttgctaaaatcgcagtttctcatgctaaagctggagcagat
atagttgctccctctgatatgatggatggaagagtaggaagaataagagaagctcttgat
gaagcaggcttttctcatgtggctattatgagctatgcagttaagtattgttcagcattc
tatggtccttttagagaagctgcagaatcagcccctaaatttggagacagacgctcctat
cagatggatccagcaaatagcagggaagctttaagagaagcatctttagatatagaagaa
ggtgccgatataataatggtaaaaccagctatgccttatttagacatcataaaaatgtta
agaaatgaatttaattatccattagcagcttatcaagtaagtggagaatatgctatgata
aaggcagcagctaaattaggatggcttgatgaagaaaaaattctttgggaaagtttaatc
tctatcaaaagggcaggagcagatttgattattacttattttgcaaaaaaaatagcaaaa
aaactaaatgaaaaataa

DBGET integrated database retrieval system