KEGG   Thermodesulfobacterium geofontis: TOPB45_0411Help
Entry
TOPB45_0411       CDS       T01547                                 

Definition
Glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TOPB45_0411
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOPB45_0411
   00052 Galactose metabolism
    TOPB45_0411
   00500 Starch and sucrose metabolism
    TOPB45_0411
   00520 Amino sugar and nucleotide sugar metabolism
    TOPB45_0411
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TOPB45_0411
   00524 Butirosin and neomycin biosynthesis
    TOPB45_0411
Enzymes [BR:top01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TOPB45_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(408096..409037)
Genome map
AA seq 313 aa AA seqDB search
MILIADIGGTNSRLALVRKKSKNFINLKIYKSKNFRNIYEVVGSYFSDLDLKKIPNVAVF
ALAGPVIKDRAYLTNLNWEVSKYKLKKFFGFKEVILLNDLQALSASILLLKKSEILNIKG
KKTLKKEPKAFIAPGTGLGEAILVKEKPLTILPTEGGHIFFSPLNEEEFKYLKFLENKEE
ELSWEKALSGKAISYWYEYYFNEVLPPEKVTELARKKDPKALKVIKKFFELLGRKISQLA
LYSLPEGGIYITGGVIQALKEFLEEQEFKEVLLRGYFKNEKLKGLLDKFSLNVILHPNPS
LLGALAILHNQQK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgattttaattgcagatatagggggaacaaactcaagattagctttagttagaaaaaaa
agtaaaaattttataaatctaaaaatttataaaagtaaaaattttagaaatatttatgaa
gtagttggaagttatttttcagatttagatttaaaaaaaattccaaatgtagcagtattt
gctttagcaggtcctgttattaaggatcgagcctatttaacaaatctaaattgggaggtt
tcaaagtataaattaaaaaaattttttgggtttaaagaagttattctgttaaatgattta
caagctttatctgcaagtatattgcttttaaaaaaaagtgaaattttaaatataaaaggt
aaaaaaactttaaaaaaggagccaaaggcatttattgctcctggaacaggattaggagaa
gctattctggtaaaagaaaaacctttaacgatacttcctacagaaggagggcatatattt
ttttctcctttaaatgaagaagagtttaaatatttaaaatttttagaaaataaagaagaa
gaattaagttgggagaaggcgctttcaggaaaagctattagttattggtatgaatactat
tttaatgaagttcttcctcctgaaaaagttacagaacttgcaagaaaaaaagatccaaag
gcattaaaagtaattaaaaaattttttgagcttttaggaagaaagatttcccaacttgca
ctttacagcttaccagaaggaggaatttatataacaggaggagtcattcaagccttaaaa
gagtttttagaagagcaagaatttaaagaggtacttttaaggggttattttaaaaatgaa
aaattaaaaggacttttagataaattttctcttaatgtgattcttcatcccaatccaagc
cttttaggagctcttgccattctccataaccaacaaaagtga

DBGET integrated database retrieval system