KEGG   Thermodesulfobacterium geofontis: TOPB45_0432Help
Entry
TOPB45_0432       CDS       T01547                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TOPB45_0432
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TOPB45_0432
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TOPB45_0432
Enzymes [BR:top01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TOPB45_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
432831..433943
Genome map
AA seq 370 aa AA seqDB search
MERKEKIQKLLNKVKKIVLKVGSAVITKEDEGLDYQVLHNLSYEINRLCKSGYKVVLVSS
GAIACGRAKLKYYKKPISLTEKQALAAVGQAALIQAYENMFQQYGIQVAQVLLTNEDLSQ
RERYLNAKKTLETLLNWKIIPIVNENDTVTTEGIRFSDNDILSALVAGTIEADILIVLSD
VDSLYKEDPRINPQAERISEVEEITPEIMNMAGKNPGRLGRGGMYSKLLSAQMVNSMGIP
MVILPGRTPLVIEKFWSGEDIGTIFWAKERKLNMRKLWIKYYIKPEGKLYIDQGAEKAIL
ENGKSLLIGGIVSVEGNFPKGACVECVNLKGKPLAKGLTNFSAQELINLRINEAKINREV
IHRDNLVILD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaggaaaaaattcaaaaattactgaataaagtaaaaaaaatagttttgaaa
gtaggaagtgctgttattacaaaagaagatgaaggacttgattatcaagttcttcataat
ttgtcttatgaaattaatagactttgtaaatcaggctataaggtagttttagtttcctct
ggagctattgcttgtgggagggctaaattaaaatattataagaaacctatttcattaaca
gaaaagcaagcattagctgcagtaggtcaggcagctttaattcaagcttatgaaaacatg
tttcagcaatatggaatccaagttgctcaggttttattgactaatgaagatttgtctcaa
agagaaagatatttaaatgctaaaaaaactttagaaacacttctaaattggaagattatt
cccattgtaaatgaaaatgatacagttactacagaagggataagatttagtgacaatgat
attttatcagcattagtagcagggactatagaagctgatattttaatagttttatctgat
gtagattcactttataaagaggatccaagaattaatcctcaagctgaaagaattagcgag
gttgaagaaataaccccagaaataatgaatatggcgggaaaaaatccaggaagattagga
agaggaggtatgtattctaagcttctttctgctcaaatggtaaattcaatgggaataccg
atggttattcttccaggaagaacccctcttgttatagaaaaattttggagcggagaagat
attgggaccatattttgggcaaaagaaagaaaactcaatatgagaaaactttggataaaa
tattatataaaaccagagggtaaactttatattgatcaaggagcagaaaaagctatctta
gaaaatggaaaaagtttattaattggaggaattgtaagtgtggaaggtaattttcccaaa
ggtgcctgtgtagaatgtgttaatcttaaaggaaaacctttagctaagggtttaaccaat
ttttcagctcaagagcttatcaatttgagaataaatgaagctaaaataaatagagaagtt
attcatagagataatctagttatcttagattaa

DBGET integrated database retrieval system