KEGG   Thermodesulfobacterium geofontis: TOPB45_0432Help
Entry
TOPB45_0432       CDS       T01547                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00330  Arginine and proline metabolism
top00332  Carbapenem biosynthesis
top01100  Metabolic pathways
top01130  Biosynthesis of antibiotics
top01230  Biosynthesis of amino acids
Module
top_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TOPB45_0432
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TOPB45_0432
Enzymes [BR:top01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TOPB45_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA PDZ_1
Motif
Other DBs
NCBI-ProteinID: AEH22536
UniProt: F8C3Z8
Position
432831..433943
Genome map
AA seq 370 aa AA seqDB search
MERKEKIQKLLNKVKKIVLKVGSAVITKEDEGLDYQVLHNLSYEINRLCKSGYKVVLVSS
GAIACGRAKLKYYKKPISLTEKQALAAVGQAALIQAYENMFQQYGIQVAQVLLTNEDLSQ
RERYLNAKKTLETLLNWKIIPIVNENDTVTTEGIRFSDNDILSALVAGTIEADILIVLSD
VDSLYKEDPRINPQAERISEVEEITPEIMNMAGKNPGRLGRGGMYSKLLSAQMVNSMGIP
MVILPGRTPLVIEKFWSGEDIGTIFWAKERKLNMRKLWIKYYIKPEGKLYIDQGAEKAIL
ENGKSLLIGGIVSVEGNFPKGACVECVNLKGKPLAKGLTNFSAQELINLRINEAKINREV
IHRDNLVILD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaggaaaaaattcaaaaattactgaataaagtaaaaaaaatagttttgaaa
gtaggaagtgctgttattacaaaagaagatgaaggacttgattatcaagttcttcataat
ttgtcttatgaaattaatagactttgtaaatcaggctataaggtagttttagtttcctct
ggagctattgcttgtgggagggctaaattaaaatattataagaaacctatttcattaaca
gaaaagcaagcattagctgcagtaggtcaggcagctttaattcaagcttatgaaaacatg
tttcagcaatatggaatccaagttgctcaggttttattgactaatgaagatttgtctcaa
agagaaagatatttaaatgctaaaaaaactttagaaacacttctaaattggaagattatt
cccattgtaaatgaaaatgatacagttactacagaagggataagatttagtgacaatgat
attttatcagcattagtagcagggactatagaagctgatattttaatagttttatctgat
gtagattcactttataaagaggatccaagaattaatcctcaagctgaaagaattagcgag
gttgaagaaataaccccagaaataatgaatatggcgggaaaaaatccaggaagattagga
agaggaggtatgtattctaagcttctttctgctcaaatggtaaattcaatgggaataccg
atggttattcttccaggaagaacccctcttgttatagaaaaattttggagcggagaagat
attgggaccatattttgggcaaaagaaagaaaactcaatatgagaaaactttggataaaa
tattatataaaaccagagggtaaactttatattgatcaaggagcagaaaaagctatctta
gaaaatggaaaaagtttattaattggaggaattgtaagtgtggaaggtaattttcccaaa
ggtgcctgtgtagaatgtgttaatcttaaaggaaaacctttagctaagggtttaaccaat
ttttcagctcaagagcttatcaatttgagaataaatgaagctaaaataaatagagaagtt
attcatagagataatctagttatcttagattaa

DBGET integrated database retrieval system