KEGG   Thermodesulfobacterium geofontis: TOPB45_0449Help
Entry
TOPB45_0449       CDS       T01547                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TOPB45_0449
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TOPB45_0449
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TOPB45_0449
Enzymes [BR:top01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TOPB45_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
452577..453791
Genome map
AA seq 404 aa AA seqDB search
MKLPNKRGYFGKFGGRFVPETLIPALYELERAYFQIKKDKSFWKEWKTLLQEYAGRPTPL
YYAENFSKYLGGHIKVYLKREDLLHTGAHKLNNTIGQVLLAKRMGKERIIAETGAGQHGV
ATATACALLNMKCVVYMGAKDTERQALNVFRMKLLGAEVIPVYSGTQTLKDAINEALRDW
VTNVRNTLYVIGSVVGPHPYPTIVRDFQSIIGIETKRQILKKEGKLPDIIIACVGGGSNA
MGIFYPFFKNKKVKFIGVEAAGHGLNTDYHSATLSVGEPGVLHGMLSYLLQDKVGQIKGA
HSIAPGLDYPGVGPEHSYFKEIKRAEYVAVTDEEALSAFQILSETEGIIPALEPAHAIAY
LIKIAKEIPKGSIVVVNLSGRGDKDVMAVKEYFEKNKKSYEKGS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcctaataaaaggggttattttggaaaatttggtggacgttttgttccggaa
acacttatcccagctttgtatgagttagaaagggcttattttcaaattaaaaaagataaa
tccttttggaaagagtggaaaactttacttcaagaatacgcaggtagaccaactcctctt
tattatgccgaaaatttttccaaatacttagggggacatataaaagtttatctcaaaaga
gaagatcttttacacacaggggctcacaagctcaataatacaattggtcaagttcttctt
gcaaaaagaatgggtaaggaacgtattattgctgaaactggagcaggtcaacatggagta
gctactgctacagcttgcgctcttctcaatatgaaatgtgttgtttatatgggtgccaaa
gatactgaaagacaagctttaaatgtttttagaatgaaacttttaggagcagaagttata
cctgtttattctggaacacagaccttaaaagatgctataaatgaagcattaagagattgg
gttacaaatgttagaaatactttatatgtaataggttctgtagtgggcccccatccttat
cccacaatagttagagattttcaaagcattataggtatagaaacaaaaagacaaatactt
aaaaaagaaggaaaacttcctgatataattatagcatgtgtaggtggtggttctaatgct
atgggcattttttatcccttttttaaaaataaaaaagtaaaatttataggagttgaggca
gcaggacacggattaaatacagattatcattcagcaacactctctgttggagagccagga
gtgcttcatggtatgttaagctatcttttacaggataaggtaggacaaataaagggagct
cattctattgctccgggtcttgattatccaggtgtagggcctgaacattcctattttaaa
gaaattaaaagggcagaatacgttgcagtaacagatgaagaggctttatctgctttccaa
attctttccgaaacagagggtataatccctgcacttgaaccagctcatgctatagcttat
ctaataaaaattgctaaagaaattcctaagggaagtatagtagttgtaaatctttcagga
agaggagataaagatgtaatggctgtaaaagaatattttgaaaaaaataaaaaatcctat
gaaaaagggagctaa

DBGET integrated database retrieval system