KEGG   Thermodesulfobacterium geofontis: TOPB45_0509Help
Entry
TOPB45_0509       CDS       T01547                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TOPB45_0509
Enzymes [BR:top01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     TOPB45_0509
Peptidases [BR:top01002]
 Cysteine Peptidases
  Family C44
   TOPB45_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
515235..516728
Genome map
AA seq 497 aa AA seqDB search
MVKKIIAEEIKDKIILGGAKTFDKVLYIYLSPDRKYLLYSNSAVALLNHHEVKKPLTLSP
KGISFFLQSGVIPTPYTIYEEVFNLSIGDYVVIYSQNGRFELEFFHEFPYPSFKRIKGKK
ADLEFILFLLVESIFKKIDPVKEIFLFQSVGKDSNTILLALAEAGLKNQTTALTLALPGS
KKDESELASEIAKKLGFKHVKLYLPERITSIEIDILEKYFSSIPFPCADGNLLAYPMYQL
QINFSGSNLLDGSGNDYYFGHVPRPIEYKRQKIYPKFKFLRPLGEALPSGNTIHKLARSR
CEMVGFIGITLVDLLKFYPQAEPVYPYWFSEDEKRKNWDYFDLKADVWVTHAEFGNVIRK
VSNFTDTFGVNLVLPWADEVLAEYIGSLDEAEVLDRKNFKNKLPLRKLLLERLEIDSDKI
GKFSYGFPILSFFEMMKDKVKEEVLNCKLWERKGIERFWKVLEERAKKDKIWQKIYGRLY
FLSAFINHSKYLSSKEF
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaagattattgcagaagaaataaaagataagataatacttggaggtgcaaaa
accttcgataaggtgttatatatttatctttcccctgatagaaaatatttactctattca
aattcagcagttgctttacttaaccatcatgaagtaaaaaaacctcttactttatctcct
aagggaatttccttttttctccaaagtggagtaataccaacaccttacactatttatgaa
gaagtctttaatcttagtataggagattatgttgtcatttattcccaaaatggaaggttt
gagcttgaattttttcatgaatttccatatcccagctttaaaaggataaaaggaaaaaaa
gctgaccttgagtttattctttttttacttgtagaatccatttttaaaaaaattgatcca
gttaaagaaatttttctttttcaaagtgtaggcaaagatagtaatactattttattagcc
cttgctgaagctggactaaaaaatcagactactgcattaactttagctcttccaggttca
aagaaagatgaaagcgagcttgcaagtgaaattgctaaaaaacttggatttaaacatgta
aaactatatttgccagaaagaatcacttctatagaaattgatatacttgaaaaatatttt
tcttctataccttttccttgtgctgatggaaatcttttagcctatcctatgtatcagtta
caaataaatttttcgggaagtaaccttcttgatggaagcggaaatgactattattttggt
catgttccaagaccaatagaatataaaaggcaaaaaatttatccaaaatttaaattttta
agacctttaggtgaggccctaccatcagggaatacaatccacaagttagcccgatctcgt
tgtgaaatggtaggtttcattggaattactttagtagatcttttgaaattctatcctcaa
gcagaaccagtttatccctattggttctctgaggatgaaaagagaaaaaattgggactat
tttgacttgaaagctgatgtctgggtaactcatgcggaatttggaaatgttataaggaaa
gtaagcaattttactgacacttttggagtaaatttagttttgccttgggctgatgaggta
ttagcagagtatatagggtctcttgatgaagctgaagttttagacagaaaaaattttaag
aataaacttcctttgagaaagcttcttcttgaaagattagagattgatagcgataaaatt
ggcaaattttcttatggtttcccgatcctttctttttttgaaatgatgaaagataaagta
aaggaagaagttttaaattgtaagctttgggaaagaaaagggatagaaagattctggaaa
gttttagaggaaagagctaaaaaagataagatttggcaaaagatatatggaaggctttat
ttcttatcagcttttattaatcatagtaaatatttaagctcaaaagaattttga

DBGET integrated database retrieval system