KEGG   Thermodesulfobacterium geofontis: TOPB45_0636Help
Entry
TOPB45_0636       CDS       T01547                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00010  Glycolysis / Gluconeogenesis
top00620  Pyruvate metabolism
top00640  Propanoate metabolism
top00680  Methane metabolism
top01100  Metabolic pathways
top01110  Biosynthesis of secondary metabolites
top01120  Microbial metabolism in diverse environments
top01130  Biosynthesis of antibiotics
top01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOPB45_0636
   00620 Pyruvate metabolism
    TOPB45_0636
   00640 Propanoate metabolism
    TOPB45_0636
  Energy metabolism
   00680 Methane metabolism
    TOPB45_0636
Enzymes [BR:top01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TOPB45_0636
Lipid biosynthesis proteins [BR:top01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TOPB45_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Baseplate_J
Motif
Other DBs
NCBI-ProteinID: AEH22738
UniProt: F8C4V4
Position
636250..638325
Genome map
AA seq 691 aa AA seqDB search
MAGGKAKEIEKEIEKEARISEAEVAVHWGEEEYIEPPEEIKRQAYVTDPTFREKFKEENF
PECFHIYADLLDWDRYWHTTLDTSNPPFWKWFVGGKLNACYNCVDRHLKKYGNKAAIIWV
PEPEDEPKRVLTYYDLYYQVNVVASVLQSLGLKAGDTVTLYMPMVPELPITMLACARLGI
IHSQVFSGFSGPACAERIIDAESKVLITIDGYWRNGKWIDHKKNADIAVNVAAERGHKVE
KVLIWQRYRDRYNSESKPIEGRDFLMKDLLKEHRGKKVPYVPMPAEAPLFIMYTSGSTGK
PKGCVHSIGGYLAYVAGTCKYIHDIHPEDIHWCMADIGWITGHSYIVYGPLALGATVLIY
EGVPTYPDPDRPWRIAERYGVTILHTAPTAIRLLKKLGSDPSKYDYKFRILVTVGEPIEP
EVWRWYYTAVGKKQAVVLDTWWQTETGGWLCAHLPGVEPMKLGSTGPGALGIYPVIYDEN
GNEIPPGSGKAGYICIKNPWPGRMLTIWKNPERMIKGYYEKFCKNKESKDWRDWPYIAGD
AATCDKRGYFRILGRMDDIINVAGHRLGTKEIESAALTVEGVAEAAVVPKIDELKGHVPD
LYISLKDGYEPSPEIAEKVKMAVRNIIGPIATPAHVYIVPDMPKTRSGKIMRRVLACISN
GRKDFGDLTTLIDPSIVEKIWEIVHGEGLTF
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaggaaaagctaaagaaattgaaaaagaaattgaaaaggaggcacgaattagt
gaagctgaagttgcagttcattggggagaagaagaatatatcgaacctccagaggaaatt
aaaagacaagcttacgtaacagatccaacttttagagaaaaatttaaagaagagaatttt
ccagaatgttttcatatctatgctgatcttttagattgggatagatattggcatacgact
cttgatacctctaatccacctttttggaaatggtttgtaggagggaaacttaatgcctgt
tataattgtgtagatcgccacttgaaaaaatatgggaataaagctgcaataatatgggtt
cctgaacctgaagatgaaccaaaaagagtattgacttactatgacttatactatcaagta
aatgtggttgcttctgtattacaatctttagggctcaaagccggtgatacagttacatta
tatatgccaatggttcctgaattaccaattactatgcttgcttgtgcgcgtttaggaata
attcactctcaagttttttcaggatttagcgggcctgcttgtgctgaaagaattattgat
gcagaaagtaaagtattaattactatagatggatattggagaaatggtaaatggattgat
cataaaaaaaatgctgatatagctgttaatgttgctgcagaaagaggacataaagttgaa
aaagttcttatatggcaaagatatcgagacagatataattctgaatcaaaacctattgaa
ggaagagactttttaatgaaagaccttttaaaagaacatagaggtaaaaaagtaccttat
gttcctatgccagcagaagcaccactttttataatgtatacttctggttctacaggtaaa
cctaaaggatgtgtccattctataggaggatatttagcttatgtagctggtacttgtaaa
tatatacatgatattcatcctgaagatattcattggtgtatggctgatattggatggata
acaggtcatagttatatagtttatggtcctttagctttaggagcaactgtattaatatat
gagggtgttcctacctatcctgatcctgatagaccttggagaattgctgaaagatatgga
gttacaattttacatacagctcctactgctattcgtttacttaaaaaattaggtagtgat
ccttcaaagtacgactataaatttagaattttagttacagttggagaacctatagaacct
gaagtttggagatggtattatacagctgtaggtaaaaaacaagcagtagttcttgatact
tggtggcaaacagaaactggaggctggttatgtgcccatttaccaggtgtagagccaatg
aaactaggaagtacaggtcctggtgcgttaggaatttatcctgtaatttatgatgaaaac
ggtaatgaaatacctccaggttcaggtaaagcaggatacatttgcataaaaaatccctgg
cctggaagaatgcttactatatggaaaaatccagaaagaatgataaagggttattatgaa
aaattctgtaaaaataaagaaagtaaagactggcgtgactggccttatatagcaggtgat
gcagctacatgtgataaaagaggatattttagaattcttggaagaatggatgatataatt
aatgtggcagggcacagacttggtacaaaagaaattgaatcagcagctcttactgtagaa
ggagttgcagaagcagcagtagttccaaaaatagatgaacttaaaggacatgttcctgat
ctttacatatctcttaaagatggttatgagccttctcctgaaatagcagaaaaagttaaa
atggcagttagaaatataattggtcctattgcaactcctgcccatgtatacatagttcct
gatatgccaaaaactcgttcaggtaaaattatgcgtagagtacttgcttgtatatcaaat
ggaagaaaagactttggagaccttacaacacttatagatccaagtatagttgaaaaaatt
tgggagatagtacacggtgaaggattaacattttaa

DBGET integrated database retrieval system