KEGG   Thermodesulfobacterium geofontis: TOPB45_0677Help
Entry
TOPB45_0677       CDS       T01547                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TOPB45_0677
   01230 Biosynthesis of amino acids
    TOPB45_0677
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOPB45_0677
   00030 Pentose phosphate pathway
    TOPB45_0677
   00051 Fructose and mannose metabolism
    TOPB45_0677
  Energy metabolism
   00680 Methane metabolism
    TOPB45_0677
Enzymes [BR:top01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TOPB45_0677
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TOPB45_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
675574..676680
Genome map
AA seq 368 aa AA seqDB search
MKLTLSVIKADIGGFVGHSSVHKDVIEKVKEVAEDGKDKGIIRDVSILVCGDDIALVMTH
TKGVDSSEVHELAWNAFKEGTEVAKKLKMYGAGQDLLADAFSGNIKGMGPGVAEMEFVER
KSEPVVIFFADKTAPSAWNLPLYEIFADPMNTAGLVIDPSMHDGFIFDVMDVYTGMGIML
KAPEELYDLLVFIGATSRYVVRAVYRKSDGEIAASASTQRLSLMAGRYVGKDDPVLIVRA
QAGFPAVGEILEPFARPWLVEGWMRGSHTGPLMPVSFKNAKPTRFDGPPRVIAAGYQITD
GYLIGPSDLFDDPAFDEARRQCNVMADILRRQGIFEPHRLPPEEMEYTTLPKVLEKLKDR
FKLVEAKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttactttgtctgttataaaggcagatataggaggtttcgtaggacattcttcg
gttcataaagatgtaattgaaaaagtaaaggaagtagctgaagatggtaaggacaaaggg
attattagagatgtatctattcttgtttgtggagatgatattgccttagtaatgactcat
acaaagggagtagattcctcagaggtgcatgaacttgcttggaatgcttttaaagaggga
acagaggttgctaaaaagctaaaaatgtatggagcagggcaggatcttttagcagatgct
ttttctggtaacattaaaggtatgggtccaggggttgcggaaatggaatttgttgagaga
aaaagtgaaccagtagttatattttttgctgataaaacagctccaagtgcttggaattta
cctttatatgaaatatttgctgatcctatgaatacagctgggcttgtaatagatccctct
atgcatgatgggtttatttttgatgttatggatgtgtatacaggaatgggtattatgctt
aaggcacctgaagaactttacgatctattagtttttattggagcaacaagtagatatgta
gtaagagcagtatatagaaaatcagatggagagattgcagcttctgcttcaacccaaaga
ctttctcttatggcaggaagatatgtaggaaaagacgatccagtgcttatagtaagagct
caggcaggtttcccagcagtgggagagattttagaaccctttgctcgtccttggttggtt
gagggatggatgagaggttctcacacaggtcctcttatgcctgtttctttcaaaaacgca
aaacctacccgttttgatggtccacctcgtgttattgctgctggttatcaaataactgat
ggatatcttattgggccttctgatttatttgatgatcctgcttttgatgaagctcggcga
caatgtaatgttatggctgatatacttagaagacaaggaatttttgaacctcatagatta
cctcctgaagaaatggaatatactacacttcctaaggtattagaaaaattaaaagataga
tttaaacttgtagaagctaaaaaataa

DBGET integrated database retrieval system