KEGG   Thermodesulfobacterium geofontis: TOPB45_0737Help
Entry
TOPB45_0737       CDS       T01547                                 

Definition
disulfide bond isomerase, DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
top  Thermodesulfobacterium geofontis
Brite
Enzymes [BR:top01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TOPB45_0737
Secretion system [BR:top02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   TOPB45_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(733755..734525)
Genome map
AA seq 256 aa AA seqDB search
MKNYFWILKSLMIFCLGFSFLISCQKVSSSSQNCPKRDSVQKSLDAIQPGIKVETVKPSP
VEGLCEVVVKLPNEEKGLFYTNLTGKYIITGSILEIKTLRNLTQEKLQDLNKKVLSKEQL
SKLDKMVDFTYGNSKNVVYFITDPDCPHCKKAEDILNKLVKEGKLTVKVILLPIEALHPD
AKSKAISLICDNKGFKELMEGYKNSNLCEKGKEKINQNISFLLNELKVRGTPTFIFPDGE
MITNVLPESYILQKFK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattatttctggattttaaaaagtttaatgattttttgtttgggtttttctttt
ttaatttcctgtcaaaaagttagtagttcctctcaaaattgtcctaaaagagattcagtt
caaaaaagtcttgatgctattcaacctggtataaaagttgaaacagtaaaaccttctcct
gtagagggtttatgtgaggtggtggttaaacttcctaatgaagaaaaaggtcttttttat
acaaatcttactggaaaatatattattactggaagcatccttgagataaaaactcttaga
aatctgactcaagaaaaacttcaggacctaaataaaaaagttctttcaaaagagcaactt
tcaaaacttgataaaatggtagattttacttatggaaattctaaaaacgtagtatatttc
attactgatccagattgtcctcattgtaaaaaggcagaggatattttaaataaattagta
aaagaggggaaacttactgttaaagtaattcttttacccatagaagctcttcatccagat
gctaagtctaaagccatatctctaatatgcgataataaaggatttaaagaattaatggaa
ggttataaaaactcaaacctttgtgaaaaaggtaaagaaaagataaatcagaatattagt
tttcttcttaatgagctaaaagtaagaggaacccctactttcatattcccggatggcgaa
atgattactaatgtattaccagaaagttacattttacaaaaatttaaataa

DBGET integrated database retrieval system