KEGG   Thermodesulfobacterium geofontis: TOPB45_0827Help
Entry
TOPB45_0827       CDS       T01547                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TOPB45_0827
Enzymes [BR:top01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     TOPB45_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
814863..815726
Genome map
AA seq 287 aa AA seqDB search
MKLTFLGLPDHPQARVALIPAPLEITTSWQKGTKEAPTEILKVSPNLEFFDEETEIEPQE
VLGFFTYPVPELPFDINTALEEISKKVRETLIKKRFPIVIGGEHTVTLGSIKALKGFYEN
LKILHLDAHLDLRDEYLGCKISHATVIRRIYEMGIPILSVGVRTLCKEEYEFIKEVNFPL
LWMKDLRENWEKSLRIIEEFIKEGDIYLSLDMDVFDPSFAPGVGTPEPGGINWYEFLQIL
KLVVRYNLVGMDIVEVKPNLGNAITEYLAAKIIFKISSYLAKKYETL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttacttttttggggctacctgaccatccccaagcaagggtagccctaattcct
gctcctttagaaattactacatcttggcaaaaaggcacaaaagaagcacctacagagatt
ctcaaagttagtcccaatttagaattctttgatgaagaaacagaaattgaaccccaagaa
gtactcggtttttttacttatccagtacctgagctaccttttgatataaatacagctctt
gaagaaatttcaaaaaaagtgagagaaactttaataaaaaagagatttcctatagtaata
ggaggagaacatacagttaccttaggaagtataaaagctttaaaaggattttatgaaaat
ttaaagatccttcatcttgatgcgcatttagatttaagggatgaatatttaggatgtaaa
atttctcatgcaactgtaataagaagaatatatgaaatggggattcctattttaagtgta
ggggtaagaacactttgtaaagaagaatatgaatttataaaggaagttaattttcctctt
ttgtggatgaaagatcttagagaaaattgggagaaaagtttaagaattatagaagagttt
attaaagagggtgatatttatctttctttagatatggatgtttttgatccctcttttgct
cctggagtaggaactcctgaacctgggggaataaactggtatgaatttttgcaaattctt
aaattagtggttagatataatttagttggaatggatatagttgaagtaaagcctaactta
ggaaatgctattacagaatatttagcagcaaaaataatttttaaaatttcctcttattta
gcaaaaaaatatgaaactctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system