KEGG   Thermodesulfobacterium sp. OPB45: TOPB45_0844Help
Entry
TOPB45_0844       CDS       T01547                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
top  Thermodesulfobacterium sp. OPB45
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:top00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:top00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
830995..832263
Genome map
AA seq 422 aa AA seqDB search
MERKYIIKGRKPLKGEIEVSGAKNASLPAICATLLAPGLYKLKNVPKVRDVFNMLKIMES
LGATYEFKKDYVEINTEKVESVFIPYELASQMRASILFLGALVGGFKSAIVPMPGGCAIG
KRPVDFHIKGISQLGGNIQLEKGNLVVSAKKLKGTQIVLDFPSVTATENLMMAACLAEGE
TIIKNSAKEPEVIFLGEMLKKMGAEIKGLGEDTIYIKGKKKLKPVNIEIIPDRIEAGTYL
VLGALMEENEVVVKNIKKEHLKTPILKLEEIGITLEDVGKDALRVKRGRILNPVKIITAP
YPGFPTDLQPFFTILLTQAEGISFITENIFENRFLYVYELKRMGAEIEVENRTAIIKGPT
PLMGSPVKATDLRAGAALVLAGLMAENTTTVYNVEFIERGYENFVEKLLSLGADIKVEED
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaatacattattaaaggtagaaagcctctaaagggtgagatagaggtaagc
ggagcaaaaaatgcttctcttcctgcaatttgtgcaactcttttagctcccggactttat
aaacttaaaaatgttcctaaggttagagatgtttttaatatgctaaaaattatggagtct
cttggagcgacttatgagtttaaaaaagattatgtggaaataaatacagaaaaagttgaa
agtgtttttattccttatgagcttgcaagtcagatgagagcctctattttatttcttggt
gctttagttggaggttttaaatctgctatagttcctatgcctggaggatgtgccatagga
aaaagacctgttgattttcatataaaagggatttctcaacttggaggaaatatacaactt
gaaaagggtaatttagttgtttctgcaaaaaaacttaaaggcactcaaatagttttagat
tttccctcagttacagctacagaaaatttaatgatggcagcatgccttgcagaaggagaa
actattattaaaaattcagccaaagaaccagaggttatctttcttggagaaatgttaaaa
aaaatgggagcagaaataaaggggcttggagaagatactatttatattaaaggaaaaaag
aagcttaagcctgttaatatagaaattattcctgatagaattgaagctggaacttatctt
gttttaggtgcccttatggaagaaaatgaggttgtagtaaaaaatataaaaaaggaacat
ttaaaaactccaattcttaaacttgaagaaattggaataaccttagaagatgttggtaaa
gatgctcttagagtaaagagaggaaggattttaaatcctgtaaaaataattactgctcct
taccctggctttcccacagatttacagcccttttttactatacttttaactcaagctgaa
ggaatatcctttataactgaaaatatttttgaaaatagatttctttatgtatatgaatta
aaaaggatgggtgcagaaatagaagtagaaaatagaacagctattataaaaggtcctact
cctttaatgggttctcctgttaaggcaacagatttgagagcaggagcagctcttgtttta
gcagggcttatggctgaaaacacaaccactgtctataatgtagaatttatagaaagggga
tacgaaaattttgtggaaaaacttctttcccttggagctgatataaaagtggaggaagat
gaaagttaa

DBGET integrated database retrieval system