KEGG   Thermodesulfobacterium geofontis: TOPB45_0994Help
Entry
TOPB45_0994       CDS       T01547                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
top  Thermodesulfobacterium geofontis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:top00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TOPB45_0994
DNA repair and recombination proteins [BR:top03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TOPB45_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
979904..980512
Genome map
AA seq 202 aa AA seqDB search
MSGVYPYTFKKLIETISQLPGLGEKSATRISFFLLSKPELCEILGELIKELPYKVKLCKF
CRNLSEEEICSICKDEKRNSELLCIVENPVSLSYIEETGVFNGYYFVLHYLLSPKDGIGP
KELGLDHMLYLIKLRNIREIIIALSPTLSGEATTSYILEVLKDYPVKVTKIACGIPMGME
IQFVDPLTLKKALFGREILKEK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagtatatccttatacttttaaaaaacttatagaaacaatttcacaacttccc
ggattaggagaaaaaagtgctacaagaatttctttttttcttttatctaaacctgaactt
tgtgaaatcttaggagagcttattaaagaattgccttataaagttaagttatgtaaattt
tgtagaaatctatctgaagaagaaatttgttccatttgtaaagatgaaaaaagaaattca
gaacttctttgtattgttgaaaatcctgttagtctttcttatatagaagaaaccggagtt
tttaatggatattattttgttttgcactatcttttatcccctaaggatggtataggacca
aaagaactgggacttgatcatatgctttatcttataaaattaagaaatataagagaaata
atcatagccctttctcccactctttcaggagaagcaaccacctcttatattcttgaagtc
ttaaaagattatccagttaaagtaactaaaatcgcttgtggtatcccaatggggatggaa
attcaatttgtagatcccttaactcttaaaaaagcactttttgggagagaaattttaaag
gaaaaatga

DBGET integrated database retrieval system