KEGG   Thermodesulfobacterium sp. OPB45: TOPB45_0994Help
Entry
TOPB45_0994       CDS       T01547                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
top  Thermodesulfobacterium sp. OPB45
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:top03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
979904..980512
Genome map
AA seq 202 aa AA seqDB search
MSGVYPYTFKKLIETISQLPGLGEKSATRISFFLLSKPELCEILGELIKELPYKVKLCKF
CRNLSEEEICSICKDEKRNSELLCIVENPVSLSYIEETGVFNGYYFVLHYLLSPKDGIGP
KELGLDHMLYLIKLRNIREIIIALSPTLSGEATTSYILEVLKDYPVKVTKIACGIPMGME
IQFVDPLTLKKALFGREILKEK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagtatatccttatacttttaaaaaacttatagaaacaatttcacaacttccc
ggattaggagaaaaaagtgctacaagaatttctttttttcttttatctaaacctgaactt
tgtgaaatcttaggagagcttattaaagaattgccttataaagttaagttatgtaaattt
tgtagaaatctatctgaagaagaaatttgttccatttgtaaagatgaaaaaagaaattca
gaacttctttgtattgttgaaaatcctgttagtctttcttatatagaagaaaccggagtt
tttaatggatattattttgttttgcactatcttttatcccctaaggatggtataggacca
aaagaactgggacttgatcatatgctttatcttataaaattaagaaatataagagaaata
atcatagccctttctcccactctttcaggagaagcaaccacctcttatattcttgaagtc
ttaaaagattatccagttaaagtaactaaaatcgcttgtggtatcccaatggggatggaa
attcaatttgtagatcccttaactcttaaaaaagcactttttgggagagaaattttaaag
gaaaaatga

DBGET integrated database retrieval system