KEGG   Thermodesulfobacterium geofontis: TOPB45_1143Help
Entry
TOPB45_1143       CDS       T01547                                 

Definition
Protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
top  Thermodesulfobacterium geofontis
Brite
Enzymes [BR:top01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TOPB45_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1142260..1142925
Genome map
AA seq 221 aa AA seqDB search
MKLSETEKDLYRIAREKMVETQIKARGIKDERVLEAMLKVPRHLFVDEALRDQAYGDFPL
PIGEGQTISQPYIVAVMTEALELKGNERVLEVGTGSGYQTAILAELAFWVYTIEKYSTLL
EKAKKILLNLGYKNISFKLGDGSLGWKEVAPFDAIIVTAAAPQIPPPLIEQLIEGGRIVI
PVGDVYSQVLIKGIKKGGKLYTETLEPVRFVKLVGAYGFKE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttcagaaaccgaaaaagatttatatagaattgcaagagaaaaaatggtagaa
actcagattaaagctcgtggtataaaagatgagcgggttttggaggctatgcttaaagta
cctcggcatttatttgtagatgaagcattgagagatcaagcttatggagattttccgctt
cctataggtgaaggacaaactatttcacaaccttacatagtagctgttatgacagaagct
ttagaattgaagggaaatgaaagggttttagaagtcggtacaggatcaggatatcaaact
gctattttagctgaattggcattttgggtttataccatagaaaagtattctactttactt
gaaaaagcaaaaaagatacttttaaatcttggttataaaaatatttcttttaaattagga
gatggaagcttaggatggaaggaagtagcaccttttgatgcaataattgttaccgcagct
gctcctcaaattcccccacctcttatagaacaactgatagaaggggggagaatagtaatt
cctgtaggggatgtttattctcaagtattaataaaaggaataaaaaagggagggaaacta
tatacagaaactttagaacctgttagattcgtaaaattagtaggcgcttatggatttaaa
gaataa

DBGET integrated database retrieval system