KEGG   Thermodesulfobacterium geofontis: TOPB45_1172Help
Entry
TOPB45_1172       CDS       T01547                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00230  Purine metabolism
top01100  Metabolic pathways
Module
top_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TOPB45_1172
Enzymes [BR:top01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TOPB45_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 dNK AAA_33 AAA_24 AAA_16 ATPase_2 AAA_22 RsgA_GTPase AAA_28 ABC_tran cobW Rad17 MMR_HSR1 AAA Gemini_AL1_M AAA_14 Dynamin_N AAA_21 AAA_29 AAA_30 T2SSE
Motif
Other DBs
NCBI-ProteinID: AEH23260
UniProt: F8C1T7
Position
1171713..1172330
Genome map
AA seq 205 aa AA seqDB search
MQKNKFLIIVVTGPSGAGKTSLLKYLPPEEFYISVSHTTRPPRKDEINGKDYYFINKEKF
LEMIKNGEFLEWVEVFGTYYGTAKSEIEKAFSQNKHLILDVEVIGATRMKSYFGNSAVFI
FILPPSIEEIEKRLKKRGTEDENKIKERIQRAKEEIKFAGWFDYIIVNDDLEKAKDNFFS
IIKAELCRPFRNNNWQNILKSLIYE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagaataaatttttaataattgttgttacaggtccttcaggagcaggtaaaacc
tcccttcttaaatatttacctcctgaagaattttatatttctgtttctcacacaactcgt
ccgcctcgtaaagatgaaataaatggaaaagattattattttataaataaagaaaagttt
ttagaaatgattaaaaatggagaatttttggaatgggtagaagtttttggtacctactat
gggactgctaaaagcgaaatagaaaaggctttttctcaaaacaaacatctgattttagat
gtagaggtaattggagcaactcgtatgaaatcctattttggtaattctgcagtttttata
tttattcttcctccaagtatagaagaaatagaaaaaagacttaaaaaaagagggacagaa
gatgaaaataaaataaaggagcgtattcaaagggcgaaagaagaaattaaatttgcaggc
tggtttgattatatcatagttaatgacgatttggaaaaagcaaaggataattttttttca
attattaaagccgaactttgtagaccctttagaaataacaattggcaaaatattttaaaa
tcattaatttatgagtaa

DBGET integrated database retrieval system