KEGG   Thermodesulfobacterium sp. OPB45: TOPB45_1172Help
Entry
TOPB45_1172       CDS       T01547                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
top  Thermodesulfobacterium sp. OPB45
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:top00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1171713..1172330
Genome map
AA seq 205 aa AA seqDB search
MQKNKFLIIVVTGPSGAGKTSLLKYLPPEEFYISVSHTTRPPRKDEINGKDYYFINKEKF
LEMIKNGEFLEWVEVFGTYYGTAKSEIEKAFSQNKHLILDVEVIGATRMKSYFGNSAVFI
FILPPSIEEIEKRLKKRGTEDENKIKERIQRAKEEIKFAGWFDYIIVNDDLEKAKDNFFS
IIKAELCRPFRNNNWQNILKSLIYE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagaataaatttttaataattgttgttacaggtccttcaggagcaggtaaaacc
tcccttcttaaatatttacctcctgaagaattttatatttctgtttctcacacaactcgt
ccgcctcgtaaagatgaaataaatggaaaagattattattttataaataaagaaaagttt
ttagaaatgattaaaaatggagaatttttggaatgggtagaagtttttggtacctactat
gggactgctaaaagcgaaatagaaaaggctttttctcaaaacaaacatctgattttagat
gtagaggtaattggagcaactcgtatgaaatcctattttggtaattctgcagtttttata
tttattcttcctccaagtatagaagaaatagaaaaaagacttaaaaaaagagggacagaa
gatgaaaataaaataaaggagcgtattcaaagggcgaaagaagaaattaaatttgcaggc
tggtttgattatatcatagttaatgacgatttggaaaaagcaaaggataattttttttca
attattaaagccgaactttgtagaccctttagaaataacaattggcaaaatattttaaaa
tcattaatttatgagtaa

DBGET integrated database retrieval system