KEGG   Thermodesulfobacterium geofontis: TOPB45_1172Help
Entry
TOPB45_1172       CDS       T01547                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TOPB45_1172
Enzymes [BR:top01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TOPB45_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1171713..1172330
Genome map
AA seq 205 aa AA seqDB search
MQKNKFLIIVVTGPSGAGKTSLLKYLPPEEFYISVSHTTRPPRKDEINGKDYYFINKEKF
LEMIKNGEFLEWVEVFGTYYGTAKSEIEKAFSQNKHLILDVEVIGATRMKSYFGNSAVFI
FILPPSIEEIEKRLKKRGTEDENKIKERIQRAKEEIKFAGWFDYIIVNDDLEKAKDNFFS
IIKAELCRPFRNNNWQNILKSLIYE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagaataaatttttaataattgttgttacaggtccttcaggagcaggtaaaacc
tcccttcttaaatatttacctcctgaagaattttatatttctgtttctcacacaactcgt
ccgcctcgtaaagatgaaataaatggaaaagattattattttataaataaagaaaagttt
ttagaaatgattaaaaatggagaatttttggaatgggtagaagtttttggtacctactat
gggactgctaaaagcgaaatagaaaaggctttttctcaaaacaaacatctgattttagat
gtagaggtaattggagcaactcgtatgaaatcctattttggtaattctgcagtttttata
tttattcttcctccaagtatagaagaaatagaaaaaagacttaaaaaaagagggacagaa
gatgaaaataaaataaaggagcgtattcaaagggcgaaagaagaaattaaatttgcaggc
tggtttgattatatcatagttaatgacgatttggaaaaagcaaaggataattttttttca
attattaaagccgaactttgtagaccctttagaaataacaattggcaaaatattttaaaa
tcattaatttatgagtaa

DBGET integrated database retrieval system