KEGG   Thermodesulfobacterium geofontis: TOPB45_1251Help
Entry
TOPB45_1251       CDS       T01547                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00260  Glycine, serine and threonine metabolism
top00400  Phenylalanine, tyrosine and tryptophan biosynthesis
top01100  Metabolic pathways
top01110  Biosynthesis of secondary metabolites
top01130  Biosynthesis of antibiotics
top01230  Biosynthesis of amino acids
Module
top_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TOPB45_1251
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TOPB45_1251
Enzymes [BR:top01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TOPB45_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP 2C_adapt Peptidase_C14 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AEH23332
UniProt: F8C274
Position
1243120..1244487
Genome map
AA seq 455 aa AA seqDB search
MEEKKILLSERELPTEWYNVLPDLPEQLPPPINPATGEPIKPEDLLPVFPISLIKQEISQ
NRWIPIPDEVLEVYKLWRPTPLVRAYELEKYLNTPARIYYKNESVSPTGSHKPNTAVAQA
YFNKIEGVKRLTTETGAGQWGSALAFACNIFGLKCRVYMVKVSYYQKPFRKSLMHIWGAE
VFPSPTNLTNAGRKILAEDPDSPGSLGIAISEAIEDAVTNEDTKYSLGSVLNHVLLHQTI
IGLETKKQLELINEKPDILIGCVGGGSNFGGFILPFVPEKLKGKSEVKFLAVEPTACPTL
TKGLYLYDFGDTVGLTPLLKMYTLGHNFVPPKIHAGGLRYHGDAPILCYLVYKNLVEAVA
YTQKAVFEAAIIFAKTEGILPAPETAHAIKAVIDEAIKCKETKEEKCIVFNFSGHGYFDI
NAYDQYLESKLEDVDYADEMIKKTLEEIKKLPGNV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaaaaaaatattgctttcagagagggaattgcctactgaatggtataatgtt
ctacctgatttacctgaacaattacctccacctataaatccagcaacaggagaacctatt
aaaccagaagatttacttccagtttttcctatctctcttataaaacaagaaatatctcaa
aatagatggatccctatacctgatgaggttttagaggtatataaattatggaggcctact
cctcttgttagagcctatgagcttgaaaaatatttaaatacacctgcaagaatatattat
aaaaatgaaagtgtatctcctacaggaagtcataagcctaatacagcagttgctcaagct
tactttaataaaattgaaggggtaaagagattaactactgaaaccggtgcaggacaatgg
ggttcagcattagcatttgcatgtaatatcttcggtcttaaatgtagagtttatatggta
aaagttagttattatcaaaaaccttttagaaagtcattaatgcatatatggggtgctgaa
gtttttccatcccctacaaatttaactaacgcaggaagaaaaattttagcagaggatcct
gattctccaggttctttaggtattgctatttctgaagcaattgaagatgctgtaaccaat
gaggatactaaatattccttaggaagtgttcttaatcatgtattacttcatcaaacaatt
ataggtcttgaaaccaaaaaacaattggaacttattaatgaaaagcctgatattttaata
ggatgtgtaggtgggggaagtaattttggaggatttattttgcccttcgttcctgaaaaa
ctcaaaggtaaaagcgaggttaaatttttagcagttgagcctactgcctgtcctaccctt
acaaagggtttatatctttatgattttggagatactgtaggacttactccccttcttaaa
atgtataccttaggacataattttgtgcctcctaaaattcatgcaggtggattaagatat
catggagatgcaccaattctttgttatcttgtttataaaaatttagttgaagcagttgca
tatacacaaaaagctgtatttgaggcagcaattatttttgctaaaactgagggtatatta
ccagcccctgagactgcacatgctataaaggctgtcattgatgaagctataaaatgtaaa
gaaactaaagaggaaaaatgtatagtatttaatttcagtggtcatgggtattttgatata
aatgcttatgatcaatatttagaaagtaaacttgaagatgttgattatgcagatgaaatg
ataaagaagaccttagaagaaattaaaaaattaccaggtaatgtttaa

DBGET integrated database retrieval system