KEGG   Thermodesulfobacterium geofontis: TOPB45_1304Help
Entry
TOPB45_1304       CDS       T01547                                 

Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TOPB45_1304
  Amino acid metabolism
   00340 Histidine metabolism
    TOPB45_1304
Enzymes [BR:top01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TOPB45_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1307730..1309028
Genome map
AA seq 432 aa AA seqDB search
MKIRIFQYPSKKAERYLQKIVNRVEEFPKKIEKEVKKIGDRVKRAGDKALIEYTYKFDGV
LLNKEDFKISKEEIERAYKEISPELFSAIKLAIEKVKKFHSQNLPQSWFIEDKGIFLGQM
VKPVEKAGLYIPGGKGGETPLISTVIMTAVPAKIAGVEKIVMVSPPRKDKTLHPALLVAA
NEAGVDEIYKVGGPWSIFALAYGTETLPKVDIICGPGNIYVTTAKKIVSSFVGIDIIAGP
SEVLIIADNTANPEFITYDLLAQAEHDPMSLSILITTSKKIAKEVKNLIPQALETGIRGE
IAKSALSKRGSIIIVKDIETAFLLANLIAPEHLEIMVKDPLDYLPLVKNAGAVFLGTFTP
EAIGDYLAGPNHVLPTMGFARFTSSLSAEKFLKKINFLKYSPSALKNEAKEVILLAETEN
LPFHAEAVKIRL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaatttttcaatatccctcaaaaaaagccgaaagatatttacaaaaaatt
gtaaatagagttgaagaatttcctaagaaaatagaaaaggaagtaaaaaaaataggggat
agagttaaaagagcgggtgataaagctttaattgagtatacctataaatttgatggagtt
cttttaaataaagaagatttcaagataagtaaagaagaaattgaaagagcttataaagag
atttcacctgagcttttttcagccataaaattagctatagaaaaggttaaaaaatttcat
tcccaaaaccttcctcaatcttggtttatagaggataaaggtatttttttaggacaaatg
gtaaaacctgtagaaaaagctggtctttatattcccggaggaaaaggaggagagactccc
ctcatttctacagtgattatgactgcagtccctgctaaaatagcaggtgtagaaaaaatt
gttatggtctcgccaccaagaaaggataaaactttacatccagctttattagttgctgct
aatgaagcaggtgttgatgaaatatataaagtaggaggtccttggtctatttttgcttta
gcctatggaactgaaaccttgcctaaggttgatattatttgtggtccaggaaatatatat
gtaaccaccgccaaaaaaattgtttcctcttttgtaggaatagacataattgctggcccc
agtgaagtattaattattgcagataatacagcaaatccagaatttatcacctatgatctt
cttgctcaagctgaacatgatcctatgagtctttcaattcttataactacttcaaaaaaa
attgctaaagaagttaaaaatttaattcctcaggctttagaaacgggaattagaggagaa
atagctaaatctgcactttcaaaaaggggaagtataataatagtaaaggatatagaaact
gcttttttattagcaaatctcattgctcctgaacacttagaaattatggttaaagacccc
ttagattatctacctttagttaaaaatgcaggtgctgtttttcttgggacttttactccc
gaggcaataggagattatttagcaggacctaatcatgtattaccaaccatgggatttgca
agatttacttcctctctatctgctgaaaaatttcttaaaaagataaattttcttaaatat
tctccctcagctttaaaaaacgaagctaaagaggttattttacttgctgaaacagaaaat
cttccctttcatgctgaagcagttaaaataaggctatag

DBGET integrated database retrieval system