KEGG   Thermodesulfobacterium geofontis: TOPB45_1456Help
Entry
TOPB45_1456       CDS       T01547                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00860  Porphyrin and chlorophyll metabolism
top01100  Metabolic pathways
top01110  Biosynthesis of secondary metabolites
top01120  Microbial metabolism in diverse environments
Module
top_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TOPB45_1456
Enzymes [BR:top01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     TOPB45_1456
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TOPB45_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase Radical_SAM QRPTase_C DUF2913 PH_12
Motif
Other DBs
NCBI-ProteinID: AEH23535
UniProt: F8C343
Position
complement(1454207..1455739)
Genome map
AA seq 510 aa AA seqDB search
MKKGKVYLVGAGPGDPGLFTLKGKKVLEEADVVIYDYLANPRLLDFCKEEAEKIYVGKKA
GAHTLPQEEINKLLVEKAKEGKIVVRLKGGDPFLFGRGGEEAEALVEENIPFEVVPGITS
AIAVPAYAGIPVTHRDYTSTLAIITGHEAENKEESKIDFLALSKIGTLIFLMGVKNLPYI
AKRLIEEGKNPNTPVAVIQWGTIPNQKTVTGTLENIAEKVKEKGITAPAIIIIGEVVKLR
EKFNWFESKPLFGKKIIITRTREQASKLAEKLEELGAICYEIPTIKVEPILNEKVFQMIE
ELSKYDWIVFTSENGVKTFLKTLWKKGKDLRALGGVKIAVIGKATKNVLENYGIFPDLIP
EKDYTQEGLVSAFSKLDLKNKYILIARAKETREVLPEKLRELGAKVEVLPIYETKICEES
KEKLKEILKEGVDLITFTSSSTVKNFFKLIEDAEKEQLKNIIFVSIGPITSSTLKEFGFE
PHIEAEEYTIEGLVRAIENYFSKNEGGVIK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggaaaggtttatttagtaggagctggaccaggagatccagggctctttact
ttaaaaggtaaaaaggttttagaagaggcagatgtagtaatttatgattatcttgctaat
ccaaggttattagatttttgtaaggaagaagcagagaagatttatgttggtaaaaaggct
ggagctcatactttaccacaagaggaaattaataaactccttgttgaaaaagctaaagaa
gggaaaatagtagtaaggcttaaaggaggagatccttttctctttggtaggggaggagaa
gaggcagaagctttggttgaagaaaatatcccctttgaagtagttcctgggataacctca
gctattgcagttcctgcttatgcaggaattcctgtaacacatagagactacacttctact
ttggcaattattacagggcacgaggctgaaaataaagaagaaagtaagatagatttttta
gctctttctaaaatagggacattaatttttttaatgggagttaagaatttaccttacatt
gctaaaaggctgatagaagaaggaaaaaatccaaatactcctgttgcagtaatccaatgg
ggtacaattcctaaccaaaaaactgttacaggtacattagaaaatattgcagaaaaagta
aaagaaaaaggtattacagctccagctataattattataggagaagtggttaagcttaga
gaaaaatttaattggtttgaatccaagcctctttttggtaaaaaaataataattactcgc
acaagagaacaggcaagtaaactggctgaaaaattagaagaacttggagcaatctgttat
gagattcctaccataaaagtagaaccaattttaaatgagaaggtttttcagatgatagag
gaattatcaaagtatgattggatagtttttacttcagaaaatggagtaaaaacattttta
aaaactttatggaaaaaaggaaaagatctgagggctttaggaggtgtaaaaatagcagtt
ataggaaaagcaactaaaaatgttttagaaaattatgggatttttccagatttaatacca
gaaaaagattatacccaagagggtttagtttctgctttttcaaagcttgatcttaaaaat
aaatatattcttatagcaagagcaaaagagacaagggaagttcttcctgaaaaacttaga
gaattaggagccaaagtggaagtacttccaatttatgaaacaaaaatttgtgaagaatct
aaggaaaaattaaaagaaattctaaaagaaggggttgatttaataacctttacaagttct
tccacagtaaaaaacttttttaaacttattgaagatgccgaaaaagagcaactaaaaaat
attatttttgtttctattggtcctattacctcttccactttaaaagaatttggttttgaa
cctcatattgaagctgaagaatataccatagaaggacttgttagagcaattgaaaactat
ttttcaaaaaatgaaggaggtgttataaagtga

DBGET integrated database retrieval system