KEGG   Thermodesulfobacterium geofontis: TOPB45_1510Help
Entry
TOPB45_1510       CDS       T01547                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00040  Pentose and glucuronate interconversions
top00052  Galactose metabolism
top00500  Starch and sucrose metabolism
top00520  Amino sugar and nucleotide sugar metabolism
top01100  Metabolic pathways
top01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TOPB45_1510
   00052 Galactose metabolism
    TOPB45_1510
   00500 Starch and sucrose metabolism
    TOPB45_1510
   00520 Amino sugar and nucleotide sugar metabolism
    TOPB45_1510
Enzymes [BR:top01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TOPB45_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase IspD NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEH23588
UniProt: F8C521
Position
complement(1513046..1513927)
Genome map
AA seq 293 aa AA seqDB search
MIRKAVIPVAGLGTRMLPITKVVPKELLNIIDRPTIEYIVDEIISSGITTLIFIISQGKG
GIIDYFDTNLNLRSFLKERGKLDLLKIVEEVEEKIKHLIEVRQKIPEGLGHAVLMAERAV
ENEPFAVVLGDDLVDAEIPCLRQMINIYNLLSNKTKNHSIIAVEEVSKEDISRYGIIDGE
RVDNNLIKIKKVIEKPSPKEAPSNLAIIGRYIFDPVIFDFLKKIPKTHGEYQLTDAIQLM
IENGYEVYAYLFEGMRFDTGNKEGFFRTILHYAIKNPNLKEVLIRFVNERKIC
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgataagaaaagcagttattcctgttgctggacttggcacaagaatgcttcctataact
aaagtagttcctaaagaacttcttaacataatagatagacctaccatagaatacatagtt
gatgagattatatcttcgggaataactacacttatatttattatttcccaaggaaaaggg
ggaattattgattattttgataccaatctaaatttaagaagttttttgaaagaaagaggg
aaattagaccttcttaaaatagtagaggaagtagaggaaaagataaaacatttaatagaa
gtgcgacagaaaattcctgaagggcttgggcatgctgtacttatggctgaaagggctgtt
gaaaatgaaccctttgcagtagtattaggagatgacttggttgatgcagagattccttgt
ctaagacagatgataaatatttataatcttctttctaataaaactaaaaatcacagcatt
attgctgtggaagaggtttctaaggaagatatttccagatatggaattattgatggggaa
agagtagataataacttaataaaaataaaaaaagttatagagaaaccttctccaaaagaa
gctccttcaaatttagctattataggaagatatattttcgacccagttatttttgatttt
ctaaaaaaaattcctaaaactcacggagaatatcaacttactgatgctattcagttaatg
atagaaaatggttatgaggtttatgcttatttatttgagggaatgagatttgatacagga
aataaagaaggattttttagaacaattcttcattacgctataaaaaatcccaatttaaaa
gaagttttgataagattcgtaaatgaaagaaaaatttgttaa

DBGET integrated database retrieval system