KEGG   Thermodesulfobacterium geofontis: TOPB45_1556Help
Entry
TOPB45_1556       CDS       T01547                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00260  Glycine, serine and threonine metabolism
top00750  Vitamin B6 metabolism
top01100  Metabolic pathways
top01110  Biosynthesis of secondary metabolites
top01120  Microbial metabolism in diverse environments
top01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TOPB45_1556
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TOPB45_1556
Enzymes [BR:top01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TOPB45_1556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Trp_halogenase DUF445 DUF2666
Motif
Other DBs
NCBI-ProteinID: AEH23634
UniProt: F8C3R7
Position
complement(1558784..1560175)
Genome map
AA seq 463 aa AA seqDB search
MKYISTRGEMPKISFKDTVFEGLAPDGGLIVPEKVPKLSEKEIEELRKLNYQELALKIFK
YYVSDIEEKDLKEIIEKAYKTFRVKDITPVVKVGDIYILELFHGPTWAFKDIALQFLGVL
FEKLLLETNKKINILGATSGDTGSAAIYGVRGKKNIAIFILHPYKKVSEVQALMMTTVTD
PNVYNIAIEGTFDDCQAIVKSLFMDLEFKRKYRLTTVNSINWARIMAQMVYYFWAYFRVS
EKEKCESIRISVPTGNFGDIFAGYLTKIMLGEKRIERLILATNENDILCRFVNNGDYSVR
KVKPTISPSMDIQVASNFERYIYYFYHEDAKKTKEIMEKFAKEKAIKFSEEEVKRVQKDF
LSASVNEEETLETIKEFYKETGYILDPHTAVGVKAGLKFKDKYPLICLATAHPAKFPETV
SKALGFSIKLPEEIEKLYKLPQKFEILPKDVEKVKAFISEKAI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacataagtactcgtggagaaatgcctaaaatttcttttaaagacacagttttt
gaaggacttgctcctgatggtggtttaattgtacctgaaaaggtaccaaaactttcagaa
aaggagatagaagaattaagaaaattaaattatcaagaattggcacttaaaatttttaaa
tactatgtttctgatatagaagaaaaggatctaaaagagattatagaaaaagcttacaaa
acttttagggtaaaagatataactccagtagtaaaagtaggagatatctatatattagaa
ctttttcacggacctacttgggcttttaaagatatagctttacaatttttaggggtattg
tttgaaaaactgctcttagaaacaaacaaaaaaattaatatcttaggagcaacttcagga
gatacaggctcagcagctatttatggagtaagaggcaaaaaaaatatagctatatttatt
ttacacccctacaaaaaagtttctgaagtccaagctttaatgatgacaactgtaactgat
cctaatgtttataatattgctatagaaggaacctttgatgattgtcaagctatagttaaa
agtttatttatggatttagaatttaaaagaaaatatagattaactacagttaattctata
aattgggcaagaataatggcacagatggtttattatttttgggcttattttagagtttct
gaaaaagagaaatgtgaaagcattagaatttcagttcctacaggaaattttggagacata
tttgcaggatatttgacaaagataatgttgggggaaaaaaggatagaaagacttatttta
gccaccaatgaaaatgatatactttgtagatttgttaataatggagattattctgtgaga
aaagtaaaaccaactataagtccctcaatggatattcaagtagcaagcaattttgaaaga
tatatttattatttttatcatgaagatgcaaaaaaaactaaagagattatggaaaaattt
gctaaagaaaaagctattaaattttcagaagaagaagtaaaaagagttcaaaaagatttt
ctttctgcctccgttaatgaagaagaaactttggaaacaataaaggaattttataaagaa
acaggttatatacttgatcctcatactgcagtaggagtaaaggcaggattaaagtttaaa
gataaataccctttaatttgtttagcaactgctcatcctgccaaattccctgaaacagta
agtaaagctttaggtttttctattaaattacctgaagaaatagaaaaactttataaactt
cctcaaaaatttgaaatccttcctaaggatgtagaaaaggttaaagctttcataagtgaa
aaagcaatttaa

DBGET integrated database retrieval system