KEGG   Thermodesulfobacterium geofontis: TOPB45_1556Help
Entry
TOPB45_1556       CDS       T01547                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TOPB45_1556
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TOPB45_1556
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TOPB45_1556
Enzymes [BR:top01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TOPB45_1556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1558784..1560175)
Genome map
AA seq 463 aa AA seqDB search
MKYISTRGEMPKISFKDTVFEGLAPDGGLIVPEKVPKLSEKEIEELRKLNYQELALKIFK
YYVSDIEEKDLKEIIEKAYKTFRVKDITPVVKVGDIYILELFHGPTWAFKDIALQFLGVL
FEKLLLETNKKINILGATSGDTGSAAIYGVRGKKNIAIFILHPYKKVSEVQALMMTTVTD
PNVYNIAIEGTFDDCQAIVKSLFMDLEFKRKYRLTTVNSINWARIMAQMVYYFWAYFRVS
EKEKCESIRISVPTGNFGDIFAGYLTKIMLGEKRIERLILATNENDILCRFVNNGDYSVR
KVKPTISPSMDIQVASNFERYIYYFYHEDAKKTKEIMEKFAKEKAIKFSEEEVKRVQKDF
LSASVNEEETLETIKEFYKETGYILDPHTAVGVKAGLKFKDKYPLICLATAHPAKFPETV
SKALGFSIKLPEEIEKLYKLPQKFEILPKDVEKVKAFISEKAI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacataagtactcgtggagaaatgcctaaaatttcttttaaagacacagttttt
gaaggacttgctcctgatggtggtttaattgtacctgaaaaggtaccaaaactttcagaa
aaggagatagaagaattaagaaaattaaattatcaagaattggcacttaaaatttttaaa
tactatgtttctgatatagaagaaaaggatctaaaagagattatagaaaaagcttacaaa
acttttagggtaaaagatataactccagtagtaaaagtaggagatatctatatattagaa
ctttttcacggacctacttgggcttttaaagatatagctttacaatttttaggggtattg
tttgaaaaactgctcttagaaacaaacaaaaaaattaatatcttaggagcaacttcagga
gatacaggctcagcagctatttatggagtaagaggcaaaaaaaatatagctatatttatt
ttacacccctacaaaaaagtttctgaagtccaagctttaatgatgacaactgtaactgat
cctaatgtttataatattgctatagaaggaacctttgatgattgtcaagctatagttaaa
agtttatttatggatttagaatttaaaagaaaatatagattaactacagttaattctata
aattgggcaagaataatggcacagatggtttattatttttgggcttattttagagtttct
gaaaaagagaaatgtgaaagcattagaatttcagttcctacaggaaattttggagacata
tttgcaggatatttgacaaagataatgttgggggaaaaaaggatagaaagacttatttta
gccaccaatgaaaatgatatactttgtagatttgttaataatggagattattctgtgaga
aaagtaaaaccaactataagtccctcaatggatattcaagtagcaagcaattttgaaaga
tatatttattatttttatcatgaagatgcaaaaaaaactaaagagattatggaaaaattt
gctaaagaaaaagctattaaattttcagaagaagaagtaaaaagagttcaaaaagatttt
ctttctgcctccgttaatgaagaagaaactttggaaacaataaaggaattttataaagaa
acaggttatatacttgatcctcatactgcagtaggagtaaaggcaggattaaagtttaaa
gataaataccctttaatttgtttagcaactgctcatcctgccaaattccctgaaacagta
agtaaagctttaggtttttctattaaattacctgaagaaatagaaaaactttataaactt
cctcaaaaatttgaaatccttcctaaggatgtagaaaaggttaaagctttcataagtgaa
aaagcaatttaa

DBGET integrated database retrieval system